Phospho-CCR5 (Ser349) Antibody | Affinity Biosciences

pElisa

1/1

Product:	Phospho-CCR5 (Ser349) Antibody
Catalog:	AF0018
Description:	Rabbit polyclonal antibody to Phospho-CCR5 (Ser349)
Application:	WB IF/ICC
Reactivity:	Human
Mol.Wt.:	40kDa; 41kD(Calculated).
Uniprot:	P51681
RRID:	AB_2834081

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human

Clonality:

Polyclonal

Specificity:

Phospho-CCR5 (Ser349) Antibody detects endogenous levels of CCR5 only when phosphorylated at Sersine 349.

RRID:

AB_2834081
Cite Format: Affinity Biosciences Cat# AF0018, RRID:AB_2834081.

Conjugate:

Unconjugated.

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

AM4 7; C C chemokine receptor type 5; C C CKR 5; C-C chemokine receptor type 5; C-C CKR-5; C-C motif chemokine receptor 5 A159A; CC Chemokine Receptor 5; CC Chemokine Receptor Type 5; CC CKR 5; CC-CKR-5; CCCKR 5; CCCKR5; CCR 5; CCR-5; CCR5; CCR5 chemokine (C C motif) receptor 5; CCR5_HUMAN; CD 195; CD195; CD195 Antigen; Chemokine C C motif receptor 5; Chemokine receptor CCR5; CHEMR13; CKR 5; CKR5; CMKBR 5; CMKBR5; FLJ78003; HIV 1 Fusion Coreceptor; HIV-1 fusion coreceptor; HIV1 fusion coreceptor; IDDM22; MIP-1 alpha receptor;

Immunogens

Immunogen:

Uniprot:

P51681(CCR5_HUMAN) >>Visit HPA database.

Gene(ID):

CCR5(1234)

Expression:

P51681 CCR5_HUMAN:

Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.

Description:

CCR5 a 7-transmembrane G-linked receptor for a number of inflammatory C-C type chemokines including MIP-1-alpha, MIP-1-beta and RANTES. Transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (along with CD4) for HIV-1 R5 isolates. Interacts with PRAF2. Interacts with HIV-1 surface protein gp120. Efficient ligand binding to CCL3/MIP-1alpha and CCR4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on S6 is required for efficient binding of CCL4.

Sequence:

P51681 CCR5_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

PTMs - P51681 As Substrate

P51681

Site	PTM Type	Enzyme	Source
S6	O-Glycosylation		Uniprot
S7	O-Glycosylation		Uniprot
T195	Phosphorylation		Uniprot
S336	Phosphorylation	A0A024R1D8 (ADRBK2) , P35626 (GRK3)	Uniprot
S337	Phosphorylation	P35626 (GRK3) , A0A024R1D8 (ADRBK2)	Uniprot
Y339	Phosphorylation		Uniprot
S342	Phosphorylation	P35626 (GRK3) , A0A024R1D8 (ADRBK2)	Uniprot
T343	Phosphorylation		Uniprot
S349	Phosphorylation	A0A024R1D8 (ADRBK2) , P35626 (GRK3)	Uniprot

Research Backgrounds

P51681_CCR5_HUMAN

Function:

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation.

(Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) of human immunodeficiency virus-1/HIV-1.

PTMs:

Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4.

O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen.

Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry.

Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Tissue Specificity:

Subunit Structure:

Interacts with PRAF2. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on Ser-6 is required for efficient binding of CCL4. Interacts with GRK2. Interacts with ARRB1 and ARRB2. Interacts with CNIH4.

(Microbial infection) Interacts with HIV-1 surface protein gp120.

(Microbial infection) May interact with human cytomegalovirus/HHV-5 protein UL78.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Phospho-CCR5 (Ser349) Antibody - #AF0018