MRGRD Antibody - #DF2820
 (1)  
			
			
			(2)
(1)  
			
			
			(2)  
			
			
		| Product: | MRGRD Antibody | 
| Catalog: | DF2820 | 
| Description: | Rabbit polyclonal antibody to MRGRD | 
| Application: | WB IHC | 
| Reactivity: | Human | 
| Mol.Wt.: | 41 kDa; 36kD(Calculated). | 
| Uniprot: | Q8TDS7 | 
| RRID: | AB_2840026 | 
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2820, RRID:AB_2840026.
Fold/Unfold
Beta alanine receptor; Beta-alanine receptor; G protein coupled receptor TGR7; G-protein coupled receptor TGR7; mas related G protein coupled MRGD; Mas related G protein coupled receptor member D; MAS related GPR member D; Mas-related G-protein coupled receptor member D; MRGD; Mrgprd; MRGRD_HUMAN; TGR7;
Immunogens
A synthesized peptide derived from human MRGRD, corresponding to a region within C-terminal amino acids.
- Q8TDS7 MRGRD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA
Research Backgrounds
May regulate nociceptor function and/or development, including the sensation or modulation of pain. Functions as a specific membrane receptor for beta-alanine. Beta-alanine at micromolar doses specifically evoked Ca(2+) influx in cells expressing the receptor. Beta-alanine decreases forskolin-stimulated cAMP production in cells expressing the receptor, suggesting that the receptor couples with G-protein G(q) and G(i).
Cell membrane>Multi-pass membrane protein. 
Note: Localized at the plasma membrane but internalized into the cytoplasm after treatment with beta-alanine.
Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
Research Fields
· Organismal Systems > Endocrine system > Renin-angiotensin system. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											