Product: EDG1 Antibody
Catalog: DF2785
Description: Rabbit polyclonal antibody to EDG1
Application: WB IHC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 43 kDa; 43kD(Calculated).
Uniprot: P21453
RRID: AB_2839991

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
EDG1 Antibody detects endogenous levels of total EDG1.
RRID:
AB_2839991
Cite Format: Affinity Biosciences Cat# DF2785, RRID:AB_2839991.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD363; CHEDG 1; CHEDG1; D1S3362; ECGF 1; ECGF1; EDG 1; EDG1; endothelial differentiation G protein coupled receptor 1; Endothelial differentiation G-protein coupled receptor 1; Endothelial differentiation sphingolipid G protein coupled receptor 1; FLJ58121; G protein coupled sphingolipid receptor; g protein-coupled receptor edg-1; S1P receptor 1; S1P receptor Edg 1; S1P receptor Edg-1; S1P receptor Edg1; S1P(1) receptor; S1P1; s1pr1; S1PR1_HUMAN; sphingolipid g-protein-coupled receptor 1; Sphingosine 1 phosphate receptor Edg 1; Sphingosine 1 phosphate receptor EDG1; sphingosine 1- phosphate receptor 1; Sphingosine 1-phosphate receptor 1; Sphingosine 1-phosphate receptor Edg-1; Sphingosine 1phosphate receptor type 1 S1P1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P21453 S1PR1_HUMAN:

Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.

Description:
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. This inducible epithelial cell G-protein-coupled receptor may be involved in the processes that regulate the differentiation of endothelial cells. Seems to be coupled to the G(i) subclass of heteromeric G proteins;
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Zebrafish
71
Xenopus
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P21453 As Substrate

Site PTM Type Enzyme
T4 O-Glycosylation
S5 O-Glycosylation
N30 N-Glycosylation
S129 Phosphorylation
Y143 Phosphorylation
T236 Phosphorylation P31749 (AKT1)
K330 Acetylation
K341 Ubiquitination
S351 Phosphorylation
S353 Phosphorylation
S355 Phosphorylation
S358 Phosphorylation
S359 Phosphorylation

Research Backgrounds

Function:

G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis (By similarity). Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.

PTMs:

S1P-induced endothelial cell migration requires the PKB/AKT1-mediated phosphorylation of the third intracellular loop at the Thr-236 residue.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Endosome. Membrane raft.
Note: Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.

Subunit Structure:

Interacts with GNAI1 and GNAI3.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

References

1). Integrated network pharmacology and metabolomics reveal vascular protective effects of Ilex pubescens on thromboangiitis obliterans. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38763010) [IF=6.7]

2). Sodium butyrate ameliorated diabetic nephropathy-associated tubulointerstitial inflammation by modulating tight junction of renal tubular epithelial cells. Food & Function, 2022 [IF=5.1]

3). Sodium butyrate ameliorated diabetic nephropathy-associated tubulointerstitial inflammation by modulating the tight junctions of renal tubular epithelial cells. Food & function, 2024 (PubMed: 38358014) [IF=5.1]

4). Neuroprotective Effects of Danshen Chuanxiongqin Injection Against Ischemic Stroke: Metabolomic Insights by UHPLC-Q-Orbitrap HRMS Analysis. Frontiers in Molecular Biosciences, 2021 (PubMed: 34026822) [IF=5.0]

Application: WB    Species: Rat    Sample: cerebral cortex and hippocampus tissue

FIGURE 8 (A,B) Western blot analysis of Sphk1 and S1PR1 in the cerebral cortex and hippocampus of rats at 24h after MCAO. (C,D) Representative photographs represented the expression of CD62P in the cerebral cortex and hippocampus at 24h reperfusion after MCAO. The positive products were brown granules after immunostaining, which was remarkably increased followed MCAO and was significantly decreased after treatment with DSCXQ. Representative images of Sphk1 and S1PR1 were presented, and the protein levels were expressed as a ratio of the β-tubulin levels (n = 3). Data were expressed with mean values ± standard deviation (SD). ##p < 0.01 vs. Sham group, **p < 0.01 *p < 0.05 vs. Model group.

Application: WB    Species: rat    Sample: cerebral cortex and hippocampus

FIGURE 8 | (A,B) Western blot analysis of Sphk1 and S1PR1 in the cerebral cortex and hippocampus of rats at 24h after MCAO.

5). Modulating intestinal barrier function by sphingosine-1-phosphate receptor 1 specific agonist SEW2871 attenuated ANIT-induced cholestatic hepatitis via the gut-liver axis. International immunopharmacology, 2023 (PubMed: 37924700) [IF=4.8]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.