FPRL1 Antibody - #DF2719
![](/images/pubmed.gif)
Product: | FPRL1 Antibody |
Catalog: | DF2719 |
Description: | Rabbit polyclonal antibody to FPRL1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Rat, Rabbit |
Mol.Wt.: | 38 kDa; 39kD(Calculated). |
Uniprot: | P25090 |
RRID: | AB_2839925 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2719, RRID:AB_2839925.
Fold/Unfold
ALXR; FMLP-R-I; FMLP-R-II; FMLP-related receptor I; FMLPX; Formyl peptide receptor 2; Formyl peptide receptor related; Formyl peptide receptor-like 1; FPR2; FPR2_HUMAN; FPR2A; FPRH1; FPRH2; FPRL1; HM63; Lipoxin A4 receptor; LXA4 receptor; LXA4R; N-formyl peptide receptor 2; RFP;
Immunogens
Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
- P25090 FPR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P25090 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T196 | Phosphorylation | Uniprot | |
S236 | Phosphorylation | Uniprot | |
S237 | Phosphorylation | Uniprot | |
Y302 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
T319 | Phosphorylation | Uniprot | |
S329 | Phosphorylation | Uniprot | |
T332 | Phosphorylation | Uniprot | |
T335 | Phosphorylation | Uniprot |
Research Backgrounds
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).
Cell membrane>Multi-pass membrane protein.
Note: Associates with Amyloid-beta protein 42, product of APP, at the cell surface and the complex is then rapidly internalized.
Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
Interacts with Amyloid-beta protein 42, product of APP; the interaction takes place at the cell surface and the complex is then rapidly internalized.
(Microbial infection) Interacts with Staphylococcus aureus protein SSL13; this interaction leads to the activation of neutrophils.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Human Diseases > Infectious diseases: Bacterial > Staphylococcus aureus infection.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.