Nkx2.5 Antibody - #DF2699
![](/images/pubmed.gif)
Product: | Nkx2.5 Antibody |
Catalog: | DF2699 |
Description: | Rabbit polyclonal antibody to Nkx2.5 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 50 kDa; 35kD(Calculated). |
Uniprot: | P52952 |
RRID: | AB_2839905 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2699, RRID:AB_2839905.
Fold/Unfold
NKX2.5, mouse, homolog of; Cardiac-specific homeobox 1; Cardiac-specific homeobox; CHNG5; CSX; CSX1; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536; HLHS2; Homeobox protein CSX; Homeobox protein NK-2 homolog E; Homeobox protein Nkx 2.5; Homeobox protein Nkx-2.5; NK2 homeobox 5; NK2 transcription factor related locus 5; NK2 transcription factor related, locus 5 (Drosophila); NK2, Drosophila, homolog of, E; NKX2-5; NKX2.5; NKX25_HUMAN; Nkx2E; NKX4-1; Tinman paralog; VSD3;
Immunogens
- P52952 NKX25_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52952 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S78 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
T180 | Phosphorylation | Uniprot | |
R225 | Methylation | Uniprot |
Research Backgrounds
Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4 (By similarity). Binds to the core DNA motif of NPPA promoter. It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B (By similarity). It is required for spleen development.
Nucleus.
Expressed only in the heart.
Homodimer (via the homeobox); binds DNA as homodimer. Interacts (via the homeobox) with TBX5 (via the T-box); this complex binds DNA. Interacts with HIPK1 and HIPK2, but not HIPK3. Interacts with the C-terminal zinc finger of GATA4 through its homeobox domain. Also interacts with JARID2 which represses its ability to activate transcription of ANF. Interacts with FBLIM1. Interacts with TBX18 (By similarity).
The homeobox domain binds to double-stranded DNA (PubMed:22849347).
Belongs to the NK-2 homeobox family.
References
Application: WB Species: Sample: miR-20b cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.