Product: CSNK2A2 Antibody
Catalog: DF2661
Description: Rabbit polyclonal antibody to CSNK2A2
Application: WB IF/ICC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Chicken, Xenopus
Mol.Wt.: 41 kDa; 41kD(Calculated).
Uniprot: P19784
RRID: AB_2839867

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(92%), Bovine(100%), Chicken(100%), Xenopus(92%)
Clonality:
Polyclonal
Specificity:
CSNK2A2 Antibody detects endogenous levels of total CSNK2A2.
RRID:
AB_2839867
Cite Format: Affinity Biosciences Cat# DF2661, RRID:AB_2839867.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Casein kinase 2 alpha prime polypeptide; Casein kinase II alpha' chain; Casein kinase II subunit alpha'; CK II alpha'; CK II; CK2A2; CKII; CSK22_HUMAN; CSNK2A1; CSNK2A2; FLJ43934;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. Participates in Wnt signaling. CK2 phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.;
Sequence:
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Bovine
100
Chicken
100
Pig
92
Xenopus
92
Horse
0
Sheep
0
Dog
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P19784 As Substrate

Site PTM Type Enzyme
Y13 Phosphorylation
S18 Phosphorylation
S21 Phosphorylation
Y24 Phosphorylation
K50 Acetylation
K69 Ubiquitination
K72 Ubiquitination
K84 Ubiquitination
R90 Methylation
K97 Acetylation
Y116 Phosphorylation
K159 Ubiquitination
S195 Phosphorylation
Y210 Phosphorylation
Y240 Phosphorylation
Y256 Phosphorylation
K260 Ubiquitination
K261 Ubiquitination
K280 Ubiquitination
S288 Phosphorylation
K304 Ubiquitination
K330 Ubiquitination
S333 Phosphorylation
C336 S-Nitrosylation
S343 Phosphorylation

PTMs - P19784 As Enzyme

Substrate Site Source
O14958-1 (CASQ2) S385 Uniprot
O43896 (KIF1C) S1092 Uniprot
P01106-2 (MYC) T73 Uniprot
P04198 (MYCN) S261 Uniprot
P04198 (MYCN) S263 Uniprot
P04818 (TYMS) S124 Uniprot
P07910-2 (HNRNPC) S247 Uniprot
P07910-1 (HNRNPC) S260 Uniprot
P09497-1 (CLTB) S11 Uniprot
P09497-1 (CLTB) S13 Uniprot
P10451-5 (SPP1) S148 Uniprot
P11836 (MS4A1) S231 Uniprot
P11836 (MS4A1) T250 Uniprot
P11836 (MS4A1) S289 Uniprot
P13349 (MYF5) S49 Uniprot
P13349 (MYF5) S133 Uniprot
P17096-2 (HMGA1) S88 Uniprot
P17096-2 (HMGA1) S91 Uniprot
P17096-2 (HMGA1) S92 Uniprot
P17096-1 (HMGA1) S99 Uniprot
P17096-1 (HMGA1) S102 Uniprot
P17096-1 (HMGA1) S103 Uniprot
P17931 (LGALS3) S6 Uniprot
P17931 (LGALS3) S12 Uniprot
P18031 (PTPN1) S352 Uniprot
P18031 (PTPN1) S378 Uniprot
P18031 (PTPN1) S386 Uniprot
P18887 (XRCC1) S485 Uniprot
P18887 (XRCC1) T488 Uniprot
P18887 (XRCC1) S518 Uniprot
P18887 (XRCC1) T519 Uniprot
P18887 (XRCC1) T523 Uniprot
P21673 (SAT1) T10 Uniprot
P21673 (SAT1) S146 Uniprot
P21673 (SAT1) S149 Uniprot
P24534 (EEF1B2) S106 Uniprot
P24534 (EEF1B2) S112 Uniprot
P32121-1 (ARRB2) T382 Uniprot
P35222 (CTNNB1) S29 Uniprot
P35222 (CTNNB1) T102 Uniprot
P35222 (CTNNB1) T112 Uniprot
P37840-1 (SNCA) S129 Uniprot
P41236 (PPP1R2) S87 Uniprot
P41236 (PPP1R2) S121 Uniprot
P41236 (PPP1R2) S122 Uniprot
P42768 (WAS) S483 Uniprot
P42768 (WAS) S484 Uniprot
P49795 (RGS19) S24 Uniprot
P51946 (CCNH) T315 Uniprot
P52655-2 (GTF2A1) S241 Uniprot
P52655-2 (GTF2A1) S242 Uniprot
P52655-2 (GTF2A1) S277 Uniprot
P52655-1 (GTF2A1) S280 Uniprot
P52655-1 (GTF2A1) S281 Uniprot
P52655-2 (GTF2A1) S282 Uniprot
P52655-1 (GTF2A1) S316 Uniprot
P52655-1 (GTF2A1) S321 Uniprot
P55087-1 (AQP4) S276 Uniprot
P55087-1 (AQP4) S285 Uniprot
P55087-1 (AQP4) S316 Uniprot
P55957-1 (BID) T59 Uniprot
P55957-1 (BID) S64 Uniprot
P60484-1 (PTEN) T366 Uniprot
P60484-1 (PTEN) S370 Uniprot
P67870 (CSNK2B) S2 Uniprot
P67870 (CSNK2B) S3 Uniprot
P84090 (ERH) T18 Uniprot
P84090 (ERH) S24 Uniprot
Q00613 (HSF1) T142 Uniprot
Q01105-2 (SET) S9 Uniprot
Q01892-1 (SPIB) S37 Uniprot
Q01892-1 (SPIB) S129 Uniprot
Q01892 (SPIB) S144 Uniprot
Q01892 (SPIB) S146 Uniprot
Q03060-16 (CREM) T63 Uniprot
Q03060-16 (CREM) S110 Uniprot
Q03135-1 (CAV1) S88 Uniprot
Q05940-1 (SLC18A2) S511 Uniprot
Q12972-2 (PPP1R8) T19 Uniprot
Q12972-2 (PPP1R8) S62 Uniprot
Q12972-1 (PPP1R8) T161 Uniprot
Q12972-1 (PPP1R8) S204 Uniprot
Q13085-1 (ACACA) S29 Uniprot
Q13085-4 (ACACA) S66 Uniprot
Q13144 (EIF2B5) S717 Uniprot
Q13144 (EIF2B5) S718 Uniprot
Q13541 (EIF4EBP1) S112 Uniprot
Q13547 (HDAC1) S421 Uniprot
Q13547 (HDAC1) S423 Uniprot
Q14005-3 (IL16) S42 Uniprot
Q14005-1 (IL16) S743 Uniprot
Q16543 (CDC37) S13 Uniprot
Q16623-1 (STX1A) S14 Uniprot
Q6FHW4 (TCF7L2) S58 Uniprot
Q6FHW4 (TCF7L2) S59 Uniprot
Q6FHW4 (TCF7L2) S60 Uniprot
Q712K3 (UBE2R2) S233 Uniprot
Q92598-1 (HSPH1) S509 Uniprot
Q92769 (HDAC2) S394 Uniprot
Q92769 (HDAC2) S422 Uniprot
Q92769 (HDAC2) S424 Uniprot
Q96SB4 (SRPK1) S51 Uniprot
Q96SB4 (SRPK1) S555 Uniprot
Q99801 (NKX3-1) T89 Uniprot
Q99801 (NKX3-1) T93 Uniprot
Q9NZU7-2 (CABP1) S120 Uniprot
Q9NZU7-1 (CABP1) S180 Uniprot
Q9UD71-2 (PPP1R1B) S9 Uniprot
Q9UD71-1 (PPP1R1B) S45 Uniprot
Q9UD71-2 (PPP1R1B) S66 Uniprot
Q9UD71-1 (PPP1R1B) S102 Uniprot
Q9UNN4-1 (GTF2A1L) S356 Uniprot
Q9UNN4-1 (GTF2A1L) S357 Uniprot
Q9UNN4-1 (GTF2A1L) S418 Uniprot
Q9UNN4-1 (GTF2A1L) S423 Uniprot
Q9UQE7 (SMC3) S1067 Uniprot
Q9Y5B0-1 (CTDP1) S575 Uniprot
Q9Y5B0 (CTDP1) S740 Uniprot

Research Backgrounds

Function:

Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.

Subunit Structure:

Heterotetramer composed of two catalytic subunits (alpha chain and/or alpha' chain) and two regulatory subunits (beta chains). The tetramer can exist as a combination of 2 alpha/2 beta, 2 alpha'/2 beta or 1 alpha/1 alpha'/2 beta subunits. Also part of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, which forms following UV irradiation. Interacts with RNPS1.

Family&Domains:

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Adherens junction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.