CSNK2A2 Antibody - #DF2661
Product: | CSNK2A2 Antibody |
Catalog: | DF2661 |
Description: | Rabbit polyclonal antibody to CSNK2A2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Chicken, Xenopus |
Mol.Wt.: | 41 kDa; 41kD(Calculated). |
Uniprot: | P19784 |
RRID: | AB_2839867 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2661, RRID:AB_2839867.
Fold/Unfold
Casein kinase 2 alpha prime polypeptide; Casein kinase II alpha' chain; Casein kinase II subunit alpha'; CK II alpha'; CK II; CK2A2; CKII; CSK22_HUMAN; CSNK2A1; CSNK2A2; FLJ43934;
Immunogens
- P19784 CSK22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P19784 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y13 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
Y24 | Phosphorylation | Uniprot | |
K50 | Acetylation | Uniprot | |
K69 | Ubiquitination | Uniprot | |
K72 | Ubiquitination | Uniprot | |
K84 | Ubiquitination | Uniprot | |
R90 | Methylation | Uniprot | |
K97 | Acetylation | Uniprot | |
Y116 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
S195 | Phosphorylation | Uniprot | |
Y210 | Phosphorylation | Uniprot | |
Y240 | Phosphorylation | Uniprot | |
Y256 | Phosphorylation | Uniprot | |
K260 | Ubiquitination | Uniprot | |
K261 | Ubiquitination | Uniprot | |
K280 | Ubiquitination | Uniprot | |
S288 | Phosphorylation | Uniprot | |
K304 | Ubiquitination | Uniprot | |
K330 | Ubiquitination | Uniprot | |
S333 | Phosphorylation | Uniprot | |
C336 | S-Nitrosylation | Uniprot | |
S343 | Phosphorylation | Uniprot |
PTMs - P19784 As Enzyme
Substrate | Site | Source |
---|---|---|
O14958-1 (CASQ2) | S385 | Uniprot |
O43896 (KIF1C) | S1092 | Uniprot |
P01106-2 (MYC) | T73 | Uniprot |
P04198 (MYCN) | S261 | Uniprot |
P04198 (MYCN) | S263 | Uniprot |
P04818 (TYMS) | S124 | Uniprot |
P07910-2 (HNRNPC) | S247 | Uniprot |
P07910-1 (HNRNPC) | S260 | Uniprot |
P09497-1 (CLTB) | S11 | Uniprot |
P09497-1 (CLTB) | S13 | Uniprot |
P10451-5 (SPP1) | S148 | Uniprot |
P11836 (MS4A1) | S231 | Uniprot |
P11836 (MS4A1) | T250 | Uniprot |
P11836 (MS4A1) | S289 | Uniprot |
P13349 (MYF5) | S49 | Uniprot |
P13349 (MYF5) | S133 | Uniprot |
P17096-2 (HMGA1) | S88 | Uniprot |
P17096-2 (HMGA1) | S91 | Uniprot |
P17096-2 (HMGA1) | S92 | Uniprot |
P17096-1 (HMGA1) | S99 | Uniprot |
P17096-1 (HMGA1) | S102 | Uniprot |
P17096-1 (HMGA1) | S103 | Uniprot |
P17931 (LGALS3) | S6 | Uniprot |
P17931 (LGALS3) | S12 | Uniprot |
P18031 (PTPN1) | S352 | Uniprot |
P18031 (PTPN1) | S378 | Uniprot |
P18031 (PTPN1) | S386 | Uniprot |
P18887 (XRCC1) | S485 | Uniprot |
P18887 (XRCC1) | T488 | Uniprot |
P18887 (XRCC1) | S518 | Uniprot |
P18887 (XRCC1) | T519 | Uniprot |
P18887 (XRCC1) | T523 | Uniprot |
P21673 (SAT1) | T10 | Uniprot |
P21673 (SAT1) | S146 | Uniprot |
P21673 (SAT1) | S149 | Uniprot |
P24534 (EEF1B2) | S106 | Uniprot |
P24534 (EEF1B2) | S112 | Uniprot |
P32121-1 (ARRB2) | T382 | Uniprot |
P35222 (CTNNB1) | S29 | Uniprot |
P35222 (CTNNB1) | T102 | Uniprot |
P35222 (CTNNB1) | T112 | Uniprot |
P37840-1 (SNCA) | S129 | Uniprot |
P41236 (PPP1R2) | S87 | Uniprot |
P41236 (PPP1R2) | S121 | Uniprot |
P41236 (PPP1R2) | S122 | Uniprot |
P42768 (WAS) | S483 | Uniprot |
P42768 (WAS) | S484 | Uniprot |
P49795 (RGS19) | S24 | Uniprot |
P51946 (CCNH) | T315 | Uniprot |
P52655-2 (GTF2A1) | S241 | Uniprot |
P52655-2 (GTF2A1) | S242 | Uniprot |
P52655-2 (GTF2A1) | S277 | Uniprot |
P52655-1 (GTF2A1) | S280 | Uniprot |
P52655-1 (GTF2A1) | S281 | Uniprot |
P52655-2 (GTF2A1) | S282 | Uniprot |
P52655-1 (GTF2A1) | S316 | Uniprot |
P52655-1 (GTF2A1) | S321 | Uniprot |
P55087-1 (AQP4) | S276 | Uniprot |
P55087-1 (AQP4) | S285 | Uniprot |
P55087-1 (AQP4) | S316 | Uniprot |
P55957-1 (BID) | T59 | Uniprot |
P55957-1 (BID) | S64 | Uniprot |
P60484-1 (PTEN) | T366 | Uniprot |
P60484-1 (PTEN) | S370 | Uniprot |
P67870 (CSNK2B) | S2 | Uniprot |
P67870 (CSNK2B) | S3 | Uniprot |
P84090 (ERH) | T18 | Uniprot |
P84090 (ERH) | S24 | Uniprot |
Q00613 (HSF1) | T142 | Uniprot |
Q01105-2 (SET) | S9 | Uniprot |
Q01892-1 (SPIB) | S37 | Uniprot |
Q01892-1 (SPIB) | S129 | Uniprot |
Q01892 (SPIB) | S144 | Uniprot |
Q01892 (SPIB) | S146 | Uniprot |
Q03060-16 (CREM) | T63 | Uniprot |
Q03060-16 (CREM) | S110 | Uniprot |
Q03135-1 (CAV1) | S88 | Uniprot |
Q05940-1 (SLC18A2) | S511 | Uniprot |
Q12972-2 (PPP1R8) | T19 | Uniprot |
Q12972-2 (PPP1R8) | S62 | Uniprot |
Q12972-1 (PPP1R8) | T161 | Uniprot |
Q12972-1 (PPP1R8) | S204 | Uniprot |
Q13085-1 (ACACA) | S29 | Uniprot |
Q13085-4 (ACACA) | S66 | Uniprot |
Q13144 (EIF2B5) | S717 | Uniprot |
Q13144 (EIF2B5) | S718 | Uniprot |
Q13541 (EIF4EBP1) | S112 | Uniprot |
Q13547 (HDAC1) | S421 | Uniprot |
Q13547 (HDAC1) | S423 | Uniprot |
Q14005-3 (IL16) | S42 | Uniprot |
Q14005-1 (IL16) | S743 | Uniprot |
Q16543 (CDC37) | S13 | Uniprot |
Q16623-1 (STX1A) | S14 | Uniprot |
Q6FHW4 (TCF7L2) | S58 | Uniprot |
Q6FHW4 (TCF7L2) | S59 | Uniprot |
Q6FHW4 (TCF7L2) | S60 | Uniprot |
Q712K3 (UBE2R2) | S233 | Uniprot |
Q92598-1 (HSPH1) | S509 | Uniprot |
Q92769 (HDAC2) | S394 | Uniprot |
Q92769 (HDAC2) | S422 | Uniprot |
Q92769 (HDAC2) | S424 | Uniprot |
Q96SB4 (SRPK1) | S51 | Uniprot |
Q96SB4 (SRPK1) | S555 | Uniprot |
Q99801 (NKX3-1) | T89 | Uniprot |
Q99801 (NKX3-1) | T93 | Uniprot |
Q9NZU7-2 (CABP1) | S120 | Uniprot |
Q9NZU7-1 (CABP1) | S180 | Uniprot |
Q9UD71-2 (PPP1R1B) | S9 | Uniprot |
Q9UD71-1 (PPP1R1B) | S45 | Uniprot |
Q9UD71-2 (PPP1R1B) | S66 | Uniprot |
Q9UD71-1 (PPP1R1B) | S102 | Uniprot |
Q9UNN4-1 (GTF2A1L) | S356 | Uniprot |
Q9UNN4-1 (GTF2A1L) | S357 | Uniprot |
Q9UNN4-1 (GTF2A1L) | S418 | Uniprot |
Q9UNN4-1 (GTF2A1L) | S423 | Uniprot |
Q9UQE7 (SMC3) | S1067 | Uniprot |
Q9Y5B0-1 (CTDP1) | S575 | Uniprot |
Q9Y5B0 (CTDP1) | S740 | Uniprot |
Research Backgrounds
Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.
Heterotetramer composed of two catalytic subunits (alpha chain and/or alpha' chain) and two regulatory subunits (beta chains). The tetramer can exist as a combination of 2 alpha/2 beta, 2 alpha'/2 beta or 1 alpha/1 alpha'/2 beta subunits. Also part of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, which forms following UV irradiation. Interacts with RNPS1.
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Adherens junction. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.