Product: FGF19 Antibody
Catalog: DF2651
Description: Rabbit polyclonal antibody to FGF19
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Rat
Prediction: Pig, Zebrafish, Bovine, Rabbit, Dog
Mol.Wt.: 24 kDa; 24kD(Calculated).
Uniprot: O95750
RRID: AB_2839857

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Prediction:
Pig(92%), Zebrafish(89%), Bovine(90%), Rabbit(92%), Dog(83%)
Clonality:
Polyclonal
Specificity:
FGF19 Antibody detects endogenous levels of total FGF19.
RRID:
AB_2839857
Cite Format: Affinity Biosciences Cat# DF2651, RRID:AB_2839857.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FGF 19; FGF-19; FGF15; FGF19; FGF19_HUMAN; Fibroblast growth factor 15; Fibroblast growth factor 19;

Immunogens

Immunogen:

A synthesized peptide derived from human FGF19, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O95750 FGF19_HUMAN:

Expressed in fetal brain, cartilage, retina, and adult gall bladder.

Description:
Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB.;
Sequence:
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
92
Pig
92
Bovine
90
Zebrafish
89
Dog
83
Horse
0
Sheep
0
Xenopus
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in fetal brain, cartilage, retina, and adult gall bladder.

Family&Domains:

Belongs to the heparin-binding growth factors family.

Research Fields

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). A human embryonic limb cell atlas resolved in space and time. Nature, 2024 (PubMed: 38057666) [IF=50.5]

2). Bacteroides fragilis alleviates necrotizing enterocolitis through restoring bile acid metabolism balance using bile salt hydrolase and inhibiting FXR-NLRP3 signaling pathway. Gut microbes, 2024 (PubMed: 39013030) [IF=12.2]

Application: WB    Species: Rat    Sample:

Figure 3. Bile acid metabolism was disorderly in NEC. (a). Enrichment plot of KEGG pathways using GSEA. (b). IHC staining of FXR in the ileum and liver. (c). IHC staining scores of FXR in the ileum and liver. (d). The protein levels of FXR and FGF19 in the ileum and comparison of grayscale values of Western blot bands. (e). The protein levels of FXR, OATP, NTCP, CYP7A1, and BSEP in the liver and comparison of grayscale values of Western blot bands. (f). The grouping and flowchart of the rat experiment (n = 10 per group). (g). Images of the small intestine in different groups and HE staining of the rat ileum. (h). The length of the small intestine in different groups. (i). Inflammatory scores of HE staining in different groups. (j). Relative mRNA expression of Il-6 in the ileum. *p 

3). Silibinin, a commonly used therapeutic agent for non-alcohol fatty liver disease, functions through upregulating intestinal expression of fibroblast growth factor 15/19. British journal of pharmacology, 2024 (PubMed: 38839561) [IF=6.8]

4). Effects of Poria cocos extract on metabolic dysfunction-associated fatty liver disease via the FXR/PPARα-SREBPs pathway. Frontiers in Pharmacology, 2022 (PubMed: 36278226) [IF=5.6]

Application: WB    Species: Rat    Sample:

FIGURE 6 EPC ameliorated MAFLD formation in rats by regulating BA metabolism. (A–G) Relative expression of CYP7A1, FXR, CYP27A1, BSEP, CYP7B1, CYP8B1, NTCP mRNA in liver, n = 6; (H–L) Relative expression of protein CYP7A1, FXR, SHP, p-AMPK, and p-ERK in the liver, n = 4; (M–N) Relative expression of protein FXR and FGF15 in the ileum, n = 4. (O–P) Representative immunoblotting images of CYP7A1, FXR, SHP, p-AMPK,and p-ERK in the liver. (Q) Representative immunoblotting images of FXR and FGF15 in the ileum. Data are presented as mean ± SEM. One-way analysis of variance (ANOVA) was conducted for the group comparison. *p < 0.05, **p < 0.01, ***p < 0.001 vs. MOD group. CYP7A1, cholesterol 7α-hydroxylase; FXR, farnesoid X receptor; CYP27A1, sterol 27-hydroxylase; BSEP, bile salt export protein; CYP7B1, oxysterol 7α-hydroxylase; CYP8B1, sterol 12αhydroxylase; NTCP, Na + -taurocholate co-transporting polypeptides; SHP, small heterodimer partner; AMPK, 5’-AMP-activated protein kinase; ERK, Extracellular signal-regulated kinase.

5). Downregulation of serum and distal ileum fibroblast growth factor19 in bile acid diarrhoea patients. DIGESTIVE DISEASES AND SCIENCES, 2022 (PubMed: 34041651) [IF=2.5]

Application: IHC    Species: Human    Sample: ileum tissue

Fig. 5 Expression of FGF19 of the terminal ileum in chronic diar- rhoea patients. a, b A positive immunoperoxidase reaction was observed in the cytoplasmatic compartment of terminal ileum mucosa epithelial cells, and some gland cells in the lamina propria. Ileum enterocytes showed FGF19 signal from apical to basal domains, espe-cially in the apical domains. c, d The staining intensity was divided into 2 categories (c pale brown = 1; d brown = 2). e–g The percentage of immunoreactive cells were calculated and classified on a 3-point scale (e 1–33% = 1; f 34–66% = 2; g 67–100% = 3)

Application: IHC    Species: human    Sample: terminal ileum mucosa epithelial cells

Fig. 5| Expression of FGF19 of the terminal ileum in chronic diarrhoea patients. a, b A positive immunoperoxidase reaction was observed in the cytoplasmatic compartment of terminal ileum mucosa epithelial cells, and some gland cells in the lamina propria. Ileum enterocytes showed FGF19 signal from apical to basal domains, especially in the apical domains.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.