HRB Antibody - #DF2639
| Product: | HRB Antibody |
| Catalog: | DF2639 |
| Description: | Rabbit polyclonal antibody to HRB |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Xenopus |
| Mol.Wt.: | 58 kDa; 58kD(Calculated). |
| Uniprot: | P52594 |
| RRID: | AB_2839845 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2639, RRID:AB_2839845.
Fold/Unfold
AGFG1; AGFG1_HUMAN; Arf-GAP domain and FG repeats-containing protein 1; ArfGAP with FG repeats 1; AU045498; C130049H11Rik; C85612; D730048C23Rik; DKFZp686I15205; HIV 1 Rev binding protein; HIV-1 Rev-binding protein; HRB; MGC116375; MGC116938; MGC116940; Nucleoporin like protein RIP; Nucleoporin-like protein RIP; RAB; Rev interacting protein; Rev-interacting protein; Rev/Rex activation domain-binding protein; RIP;
Immunogens
- P52594 AGFG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52594 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R18 | Methylation | Uniprot | |
| Y39 | Phosphorylation | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K114 | Ubiquitination | Uniprot | |
| K120 | Acetylation | Uniprot | |
| K120 | Ubiquitination | Uniprot | |
| K123 | Acetylation | Uniprot | |
| K124 | Acetylation | Uniprot | |
| S142 | Phosphorylation | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| S146 | Phosphorylation | Uniprot | |
| S147 | Phosphorylation | Uniprot | |
| S149 | Phosphorylation | Uniprot | |
| T151 | Phosphorylation | Uniprot | |
| T154 | Phosphorylation | Uniprot | |
| K161 | Methylation | Uniprot | |
| S162 | Phosphorylation | Uniprot | |
| S167 | Phosphorylation | Uniprot | |
| T170 | Phosphorylation | Uniprot | |
| K175 | Ubiquitination | Uniprot | |
| T177 | Phosphorylation | Uniprot | |
| S179 | Phosphorylation | Uniprot | |
| S181 | Phosphorylation | Uniprot | |
| K194 | Acetylation | Uniprot | |
| S291 | Phosphorylation | Uniprot | |
| S293 | Phosphorylation | Uniprot | |
| T298 | Phosphorylation | Uniprot | |
| T301 | Phosphorylation | Uniprot | |
| S302 | Phosphorylation | Uniprot | |
| S304 | Phosphorylation | Uniprot | |
| T307 | Phosphorylation | Uniprot | |
| K313 | Ubiquitination | Uniprot | |
| K318 | Ubiquitination | Uniprot | |
| T323 | Phosphorylation | Uniprot | |
| Y327 | Phosphorylation | Uniprot | |
| S362 | Phosphorylation | Uniprot | |
| S365 | Phosphorylation | Uniprot | |
| S368 | Phosphorylation | Uniprot | |
| R456 | Methylation | Uniprot | |
| Y480 | Phosphorylation | Uniprot | |
| T544 | Phosphorylation | Uniprot | |
| S556 | Phosphorylation | Uniprot | |
| S557 | Phosphorylation | Uniprot | |
| T558 | Phosphorylation | Uniprot |
Research Backgrounds
Required for vesicle docking or fusion during acrosome biogenesis (By similarity). May play a role in RNA trafficking or localization. In case of infection by HIV-1, acts as a cofactor for viral Rev and promotes movement of Rev-responsive element-containing RNAs from the nuclear periphery to the cytoplasm. This step is essential for HIV-1 replication.
O-glycosylated.
Nucleus. Cytoplasmic vesicle.
Ubiquitously expressed.
Interacts with EPS15R and EPS15. Interacts with FCHO1.
Contains FG repeats. The FG repeat region is required for acting as a cofactor of HIV-1 Rev.
Research Fields
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.