DYNLL1 Antibody - #DF2630
Product: | DYNLL1 Antibody |
Catalog: | DF2630 |
Description: | Rabbit polyclonal antibody to DYNLL1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 10 kDa; 10kD(Calculated). |
Uniprot: | P63167 |
RRID: | AB_2839836 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2630, RRID:AB_2839836.
Fold/Unfold
8 kDa dynein light chain; 8kDLC; Cytoplasmic dynein light polypeptide; DLC1; DLC8; DNCL1; DNCLC1; DYL1_HUMAN; Dynein , cytoplasmic, light chain 1; Dynein light chain 1 cytoplasmic; Dynein light chain 1, cytoplasmic; Dynein light chain LC8 type 1; Dynein light chain LC8-type 1; Dynein, cytoplasmic, light polypeptide 1; Dynein, light chain, LC8-type 1; DYNLL1; HDLC1; LC8; LC8a; MGC126137; MGC126138; MGC72986; PIN; Protein inhibitor of neuronal nitric oxide synthase; Protein inhibitor of neuronal NOS;
Immunogens
- P63167 DYL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P63167 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K9 | Acetylation | Uniprot | |
K9 | Sumoylation | Uniprot | |
K9 | Ubiquitination | Uniprot | |
S14 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
C24 | S-Nitrosylation | Uniprot | |
K31 | Ubiquitination | Uniprot | |
K36 | Acetylation | Uniprot | |
K36 | Ubiquitination | Uniprot | |
K43 | Sumoylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K44 | Acetylation | Uniprot | |
K49 | Methylation | Uniprot | |
K49 | Sumoylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
C56 | S-Nitrosylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
Y65 | Phosphorylation | Uniprot | |
T67 | Phosphorylation | Uniprot | |
S88 | Phosphorylation | Q13153 (PAK1) | Uniprot |
Research Backgrounds
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.
Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.
Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.
Phosphorylation at Ser-88 appears to control the dimer-monomer transition. According to it is phosphorylated at Ser-88 by PAK1, however, according to the DYNLL1 dimer is not accessible for PAK1 and the phosphorylation could not be demonstrated in vitro.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton. Nucleus. Mitochondrion.
Note: Upon induction of apoptosis translocates together with BCL2L11 to mitochondria.
Ubiquitous.
Homodimer. Monomer; the monomeric form is incapable of binding to target proteins. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs); the composition seems to vary in respect to the IC, LIC and LC composition. The heavy chain homodimer serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits. The ICs and LICs bind directly to the HC dimer and the LCs assemble on the IC dimer. Interacts with TXNDC17. Interacts with WWC1 and ESR1. The WWC1-DYNLL1 interaction is mandatory for the recruitment and transactivation functions of ESR1 or DYNLL1 to the target chromatin. Interacts with BCL2L11 isoform 1 and isoform 2. Interacts with BCL2; the interaction is greatly enhanced in the nucleus and in mitochondria upon induction of apoptosis. Interacts with PAK1; the interaction requires dimeric DYNLL1. Interacts with MYZAP. Part of an astrin (SPAG5)-kinastrin (SKAP) complex containing KNSTRN, SPAG5, PLK1, DYNLL1 and SGO2. Interacts with ATMIN; this interaction inhibits ATMIN transcriptional activity and hence may play a role in a feedback loop whereby DYNLL1 inhibits transactivation of its own promoter by ATMIN. Interacts with NEK9 (not phosphorylated at 'Ser-944'). Interacts with BICD2 (By similarity). Interacts with BCAS1 (By similarity). Interacts with Basson/BSN. Interacts with HDAC6. Interacts with TPPP.
(Microbial infection) Interacts with human spumaretrovirus Gag protein; this interaction is critical for intracellular microtubule-dependent viral genome transport toward the centrosome.
(Microbial infection) Interacts with ebolavirus protein VP35; this interaction stabilizes VP35 N-terminal oligomerization domain and enhances viral RNA synthesis.
Belongs to the dynein light chain family.
Research Fields
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.