IL9 Antibody - #DF2532
Product: | IL9 Antibody |
Catalog: | DF2532 |
Description: | Rabbit polyclonal antibody to IL9 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 16 kDa; 16kD(Calculated). |
Uniprot: | P15248 |
RRID: | AB_2839738 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2532, RRID:AB_2839738.
Fold/Unfold
Cytokine P40; Homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; IL-9; Il9; IL9_HUMAN; Interleukin 9; Interleukin-9; Mast cell growth factor; MCGF; Megakaryoblast growth factor; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor 3; T cell growth factor p40; T-cell growth factor P40; TCGF 3;
Immunogens
A synthesized peptide derived from human IL9, corresponding to a region within the internal amino acids.
- P15248 IL9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Research Backgrounds
Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Secreted.
Belongs to the IL-7/IL-9 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Immune diseases > Asthma.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.