IL25 Antibody - #DF2528
Product: | IL25 Antibody |
Catalog: | DF2528 |
Description: | Rabbit polyclonal antibody to IL25 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 20 kDa; 20kD(Calculated). |
Uniprot: | Q9H293 |
RRID: | AB_2839734 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2528, RRID:AB_2839734.
Fold/Unfold
IL 17E; IL 25; IL-17E; IL-25; IL17e; IL25; IL25_HUMAN; Interleukin 17E; Interleukin 25; Interleukin-17E; Interleukin-25; Interleukin17E; Interleukin25; OTTHUMP00000027946; OTTHUMP00000246238; UNQ3120/PRO10272;
Immunogens
Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
- Q9H293 IL25_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
PTMs - Q9H293 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y92 | Phosphorylation | Uniprot |
Research Backgrounds
Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
Secreted.
Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
Belongs to the IL-17 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)
References
Application: WB Species: Mice Sample: 3T3 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.