Interleukin 20 Antibody - #DF2527
| Product: | Interleukin 20 Antibody |
| Catalog: | DF2527 |
| Description: | Rabbit polyclonal antibody to Interleukin 20 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Rabbit, Dog |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | Q9NYY1 |
| RRID: | AB_2839733 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2527, RRID:AB_2839733.
Fold/Unfold
Cytokine Zcyto10; Four alpha helix cytokine; IL-20; IL10D; IL20; IL20_HUMAN; Interleukin 20; Interleukin-20; MGC96907; UNQ852/PRO1801; ZCYTO10;
Immunogens
Expressed in most tissues and five major cell types: epithelial cells (primarily skin, buccal mucosa, tongue, nasal mucosa, lung, ureter, breast, prostate, fallopian tube, and adrenal gland), myoepithelial cells (mainly prostate), endothelial cells (mainly in small vessels or capillaries), macrophages, and skeletal muscle. Isoform 2 was detected in the lung tissue only.
- Q9NYY1 IL20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NYY1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S4 | Phosphorylation | Uniprot | |
| S5 | Phosphorylation | Uniprot | |
| S12 | Phosphorylation | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| T175 | Phosphorylation | Uniprot |
Research Backgrounds
Proinflammatory and angiogenic cytokine that may be involved in epidermal function and psoriasis. Angiogenic and proliferative activities are antagonized by IL10. May act through STAT3.
Secreted.
Expressed in most tissues and five major cell types: epithelial cells (primarily skin, buccal mucosa, tongue, nasal mucosa, lung, ureter, breast, prostate, fallopian tube, and adrenal gland), myoepithelial cells (mainly prostate), endothelial cells (mainly in small vessels or capillaries), macrophages, and skeletal muscle. Isoform 2 was detected in the lung tissue only.
Forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.
Belongs to the IL-10 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.