IL11 Antibody - #DF2518
Product: | IL11 Antibody |
Catalog: | DF2518 |
Description: | Rabbit polyclonal antibody to IL11 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Dog |
Mol.Wt.: | 27 kDa; 21kD(Calculated). |
Uniprot: | P20809 |
RRID: | AB_2839724 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2518, RRID:AB_2839724.
Fold/Unfold
Adipogenesis inhibitory factor; AGIF; IL 11; IL-11; Il11; IL11_HUMAN; Interleukin 11; Interleukin-11; Oprelvekin;
Immunogens
- P20809 IL11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P20809 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S41 | Phosphorylation | Uniprot | |
T42 | Phosphorylation | Uniprot | |
T46 | Phosphorylation | Uniprot | |
T184 | Phosphorylation | Uniprot |
Research Backgrounds
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.
Secreted.
Interacts with IL6ST and either IL11RA1 or IL11RA2, giving rise to a multimeric signaling complex.
Belongs to the IL-6 superfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.