FGF5 Antibody - #DF2496

(2)   (1)  
Product: FGF5 Antibody
Catalog: DF2496
Description: Rabbit polyclonal antibody to FGF5
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 30 kDa; 30kD(Calculated).
Uniprot: P12034
RRID: AB_2839702

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
FGF5 Antibody detects endogenous levels of total FGF5.
RRID:
AB_2839702
Cite Format: Affinity Biosciences Cat# DF2496, RRID:AB_2839702.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FGF 5; FGF-5; FGF5; FGF5_HUMAN; Fibroblast growth factor 5; HBGF 5; HBGF-5; heparin binding growth factor 5; Heparin-binding growth factor 5; Smag 82; Smag-82; TCMGLY;

Immunogens

Immunogen:
Uniprot:

P12034(FGF5_HUMAN) >>Visit HPA database.

Gene(ID):
FGF5(2250)
Expression:
P12034 FGF5_HUMAN:

Expressed in neonatal brain.

Description:
Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.
Sequence:
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

PTMs - P12034 As Substrate

Site PTM Type Enzyme
S250 Phosphorylation

Research Backgrounds

Function:

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase (By similarity).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in neonatal brain.

Subunit Structure:

Interacts with FGFR1 and FGFR2. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors.

Family&Domains:

Belongs to the heparin-binding growth factors family.

Research Fields

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Melanoma.   (View pathway)

· Human Diseases > Cancers: Specific types > Breast cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). Hair growth predicts a depression-like phenotype in rats as a mirror of stress traceability. NEUROCHEMISTRY INTERNATIONAL, 2021 (PubMed: 34166749) [IF=4.2]

Application: WB    Species: Rat    Sample: Hippocampus tissue

Fig. 5. Down-regulation of the glucocorticoid re- ceptor (GR), fibroblast growth factor 2 (FGF2), brain-derived neurotrophic factor (BDNF) expres- sion in the hippocampus, and fibroblast growth factor 5 (FGF5) expression in the skin of stressed rats. (A) Western blotting and quantification of GR, FGF2, and BDNF expression in the hippocampus; (B) Western blotting and quantification of FGF5 expression in the skin. All data are shown as mean ± SEM; n = 4; * denotes significance compared with control, *p < 0.05, ***p < 0.001.
2). WITHDRAWN: Circ_0041732 regulates tumor progression and angiogenesis by miR-149-5p/FGF5 pathway in triple negative breast cancer. Pathology - Research and Practice, 2021 [IF=2.8]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.