TNF18 Antibody - #DF2483
Product: | TNF18 Antibody |
Catalog: | DF2483 |
Description: | Rabbit polyclonal antibody to TNF18 |
Application: | WB IHC |
Reactivity: | Human, Monkey |
Prediction: | Horse, Rabbit |
Mol.Wt.: | 72 kDa; 23kD(Calculated). |
Uniprot: | Q9UNG2 |
RRID: | AB_2839689 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2483, RRID:AB_2839689.
Fold/Unfold
Activation inducible TNF related ligand; Activation-inducible TNF-related ligand; AITR ligand; AITRL; GITR ligand; GITRL; Glucocorticoid induced TNF related ligand; Glucocorticoid induced TNFR related protein ligand; Glucocorticoid-induced TNF-related ligand; hGITRL; MGC138237; TL6; TNF18_HUMAN; TNFSF18; TNLG2A; Tumor necrosis factor (ligand) superfamily member 18; Tumor necrosis factor ligand 2A; Tumor necrosis factor ligand superfamily member 18;
Immunogens
Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
- Q9UNG2 TNF18_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1. Promotes leukocyte adhesion to endothelial cells. Regulates migration of monocytes from the splenic reservoir to sites of inflammation (By similarity).
Cell membrane>Single-pass type II membrane protein.
Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
Homodimer (By similarity). Homotrimer.
Belongs to the tumor necrosis factor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.