CD48 Antibody - #DF2302
Product: | CD48 Antibody |
Catalog: | DF2302 |
Description: | Rabbit polyclonal antibody to CD48 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine |
Mol.Wt.: | 28 kDa; 28kD(Calculated). |
Uniprot: | P09326 |
RRID: | AB_2839526 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2302, RRID:AB_2839526.
Fold/Unfold
Antigen CD48; B cell membrane protein; B lymphocyte activation marker BLAST 1; B-cell activation marker; B-lymphocyte activation marker BLAST-1; BCM 1 surface antigen; BCM1; BCM1 surface antigen; BLAST 1; BLAST; BLAST1; CD 48; CD48; CD48 antigen (B cell membrane protein); CD48 antigen; CD48 molecule; CD48 protein; CD48_HUMAN; hCD48; Leucocyte antigen MEM 102; Leukocyte antigen MEM-102; mCD48; MEM 102; MEM-102; MEM102; Signaling lymphocytic activation molecule 2; SLAM family member 2; SLAMF 2; SLAMF2; TCT.1;
Immunogens
- P09326 CD48_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09326 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y76 | Phosphorylation | Uniprot | |
N104 | N-Glycosylation | Uniprot | |
K124 | Ubiquitination | Uniprot | |
N189 | N-Glycosylation | Uniprot |
Research Backgrounds
Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
Cell membrane>Lipid-anchor.
Interacts with CD2. Interacts with CD244 in a heterophilic manner.
Research Fields
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.