ELL2 Antibody - #DF2232
Product: | ELL2 Antibody |
Catalog: | DF2232 |
Description: | Rabbit polyclonal antibody to ELL2 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 72 kDa; 72kD(Calculated). |
Uniprot: | O00472 |
RRID: | AB_2839463 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2232, RRID:AB_2839463.
Fold/Unfold
ELL related RNA polymerase II elongation factor; Ell2; ELL2_HUMAN; Elongation factor for RNA polymerase II 2; Elongation factor RNA for polymerase II 2; Elongation factor RNA polymerase II 2; RNA polymerase II elongation factor ELL2;
Immunogens
- O00472 ELL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIPKNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00472 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T37 | Phosphorylation | Uniprot | |
S145 | Phosphorylation | Uniprot | |
Y258 | Phosphorylation | Uniprot | |
S282 | Phosphorylation | Uniprot | |
K290 | Ubiquitination | Uniprot | |
S303 | Phosphorylation | Uniprot | |
S305 | Phosphorylation | Uniprot | |
S309 | Phosphorylation | Uniprot | |
S310 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
S414 | Phosphorylation | Uniprot | |
S416 | Phosphorylation | Uniprot | |
S420 | Phosphorylation | Uniprot | |
K428 | Ubiquitination | Uniprot | |
K446 | Ubiquitination | Uniprot | |
K470 | Acetylation | Uniprot | |
K476 | Acetylation | Uniprot | |
K486 | Sumoylation | Uniprot | |
S502 | Phosphorylation | Uniprot | |
S503 | Phosphorylation | Uniprot | |
S506 | Phosphorylation | Uniprot | |
T515 | Phosphorylation | Uniprot | |
Y528 | Phosphorylation | Uniprot | |
S580 | Phosphorylation | Uniprot | |
K584 | Ubiquitination | Uniprot | |
K599 | Ubiquitination | Uniprot | |
K601 | Ubiquitination | Uniprot | |
S604 | Phosphorylation | Uniprot |
Research Backgrounds
Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III. Plays a role in immunoglobulin secretion in plasma cells: directs efficient alternative mRNA processing, influencing both proximal poly(A) site choice and exon skipping, as well as immunoglobulin heavy chain (IgH) alternative processing. Probably acts by regulating histone modifications accompanying transition from membrane-specific to secretory IgH mRNA expression.
Ubiquitinated by SIAH1, leading to its degradation by the proteaseome. Interaction with AFF4 stabilizeS ELL2 and prevent ELL2 ubiquitination.
Nucleus.
Component of the super elongation complex (SEC), at least composed of EAF1, EAF2, CDK9, MLLT3/AF9, AFF (AFF1 or AFF4), the P-TEFb complex and ELL (ELL, ELL2 or ELL3). Component of the little elongation complex (LEC), at least composed of ELL (ELL, ELL2 or ELL3), ZC3H8, ICE1 and ICE2. Interacts with AFF4; the interaction is direct and leads to stabilize ELL2 and prevent ELL2 ubiquitination. Interacts with EAF1 and EAF2.
Belongs to the ELL/occludin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.