ATP1B1 Antibody - #DF7473
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7473, RRID:AB_2839410.
Fold/Unfold
Adenosinetriphosphatase; AT1B1_HUMAN; ATP 1B; ATP1B; ATP1B1; ATPase Na+/K+ transporting beta 1 polypeptide; Atpb 1; ATPBS; Beta 1 subunit of Na(+) K(+) ATPase; Na K ATPase beta 1 polypeptide; Na+/K+ ATPase beta 1 subunit; Sodium/potassium dependent ATPase beta 1 subunit; Sodium/potassium transporting ATPase beta 1 chain; Sodium/potassium transporting ATPase subunit beta 1; Sodium/potassium-dependent ATPase subunit beta-1; Sodium/potassium-transporting ATPase subunit beta-1;
Immunogens
- P05026 AT1B1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P05026 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K13 | Ubiquitination | Uniprot | |
| K14 | Ubiquitination | Uniprot | |
| K21 | Ubiquitination | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| Y101 | Phosphorylation | Uniprot | |
| K113 | Ubiquitination | Uniprot | |
| R118 | Methylation | Uniprot | |
| K134 | Ubiquitination | Uniprot | |
| K147 | Ubiquitination | Uniprot | |
| K152 | Ubiquitination | Uniprot | |
| N158 | N-Glycosylation | Uniprot | |
| K170 | Ubiquitination | Uniprot | |
| K173 | Ubiquitination | Uniprot | |
| K179 | Ubiquitination | Uniprot | |
| K187 | Ubiquitination | Uniprot | |
| N193 | N-Glycosylation | Uniprot | |
| K216 | Ubiquitination | Uniprot | |
| K221 | Ubiquitination | Uniprot | |
| K223 | Ubiquitination | Uniprot | |
| Y229 | Phosphorylation | Uniprot | |
| S235 | Phosphorylation | Uniprot | |
| K248 | Ubiquitination | Uniprot | |
| Y254 | Phosphorylation | Uniprot | |
| N265 | N-Glycosylation | Uniprot | |
| K277 | Ubiquitination | Uniprot | |
| Y285 | Phosphorylation | Uniprot | |
| K288 | Ubiquitination | Uniprot |
Research Backgrounds
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.
Involved in cell adhesion and establishing epithelial cell polarity.
Glutathionylated.
Cell membrane>Single-pass type II membrane protein. Cell membrane>Sarcolemma.
Note: Colocalizes with OBSCN at the intercalated disk and sarcolemma in cardiomyocytes. Localizes in long striations at the level of Z and M lines.
Found in most tissues.
The sodium/potassium-transporting ATPase is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit. Interacts with regulatory subunit FXYD1 (By similarity). Interacts with regulatory subunit FXYD3 (By similarity). Interacts with NKAIN1, NKAIN2 and NKAIN4 (By similarity). Interacts with MLC1. Part of a complex containing MLC1, TRPV4, AQP4 and HEPACAM. Interacts with KIRREL3. Interacts with OBSCN (via protein kinase domain 1) (By similarity).
The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
Belongs to the X(+)/potassium ATPases subunit beta family.
Research Fields
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
· Organismal Systems > Excretory system > Proximal tubule bicarbonate reclamation.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Gastric acid secretion.
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.
· Organismal Systems > Digestive system > Protein digestion and absorption.
· Organismal Systems > Digestive system > Mineral absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.