PPARD Antibody - #DF7442
Product: | PPARD Antibody |
Catalog: | DF7442 |
Description: | Rabbit polyclonal antibody to PPARD |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 49kDa; 50kD(Calculated). |
Uniprot: | Q03181 |
RRID: | AB_2839380 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7442, RRID:AB_2839380.
Fold/Unfold
FAAR; MGC3931; NR1C2; NUC1; NUCI; NUCII; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferative activated receptor delta; Peroxisome proliferator-activated receptor beta (PPAR-beta); Peroxisome proliferator-activated receptor beta; Peroxisome proliferator-activated receptor delta; PPAR beta; PPAR-beta; PPAR-delta; PPAR-ß; PPARB; ppard; PPARD_HUMAN;
Immunogens
- Q03181 PPARD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q03181 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T252 | Phosphorylation | Uniprot | |
T253 | Phosphorylation | Uniprot | |
T256 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
Nucleus.
Ubiquitous with maximal levels in placenta and skeletal muscle.
Heterodimer with the retinoid X receptor. Interacts (via domain NR LBD) with CRY1 and CRY2 in a ligand-dependent manner (By similarity).
Belongs to the nuclear hormone receptor family. NR1 subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)
· Organismal Systems > Endocrine system > PPAR signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.