GABARAP Antibody - #DF7419
| Product: | GABARAP Antibody |
| Catalog: | DF7419 |
| Description: | Rabbit polyclonal antibody to GABARAP |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 13kDa; 14kD(Calculated). |
| Uniprot: | O95166 |
| RRID: | AB_2839357 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7419, RRID:AB_2839357.
Fold/Unfold
ATG8A; FLC 3B; FLC3B; FLJ25768; GABA(A) receptor associated protein; GABA(A) receptor-associated protein; GABARAP a; GABARAP; Gamma aminobutyric acid receptor associated protein; Gamma-aminobutyric acid receptor-associated protein; GBRAP_HUMAN; MGC120154; MGC120155; MM 46; MM46;
Immunogens
- O95166 GBRAP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95166 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K6 | Ubiquitination | Uniprot | |
| K13 | Ubiquitination | Uniprot | |
| K23 | Ubiquitination | Uniprot | |
| K24 | Ubiquitination | Uniprot | |
| R28 | Methylation | Uniprot | |
| K35 | Acetylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| Y49 | Phosphorylation | Uniprot | |
| T56 | Phosphorylation | Uniprot | |
| Y61 | Phosphorylation | Uniprot |
Research Backgrounds
Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.
The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAP-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAP-II.
Endomembrane system. Cytoplasm>Cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle>Autophagosome. Cytoplasmic vesicle.
Note: Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae. Colocalizes with microtubules (By similarity). Localizes also to discrete punctae along the ciliary axoneme (By similarity).
Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
Interacts with GPHN and NSF (By similarity). Interacts with ATG3, ATG7, ATG13. Interacts with alpha- and beta-tubulin. Interacts with GABRG2. Interacts with RB1CC1. Interacts with ULK1. Interacts with CALR. Interacts with DDX47. Interacts with TP53INP1 and TP53INP2. Interacts with TBC1D5 and TBC1D25. Directly interacts with SQSTM1. Interacts with MAPK15. Interacts with TECPR2. Interacts with PCM1. Interacts with TRIM5 and TRIM21. Interacts with MEFV. Interacts with KIF21B (By similarity). Interacts with WDFY3; this interaction is required for WDFY3 recruitment to MAP1LC3B-positive p62/SQSTM1 bodies. Interacts with the reticulophagy receptor TEX264.
Belongs to the ATG8 family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
· Organismal Systems > Nervous system > GABAergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.