LITAF Antibody - #DF7357
Product: | LITAF Antibody |
Catalog: | DF7357 |
Description: | Rabbit polyclonal antibody to LITAF |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 17kDa; 17kD(Calculated). |
Uniprot: | Q99732 |
RRID: | AB_2839295 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7357, RRID:AB_2839295.
Fold/Unfold
Lipopolysaccharide induced TNF alpha factor; CMT1C; FLJ38636; Lipopolysaccharide induced TNF alpha factor; Lipopolysaccharide induced TNF factor; Lipopolysaccharide induced tumor necrosis factor alpha factor; Lipopolysaccharide-induced tumor necrosis factor-alpha factor; LITAF; LITAF_HUMAN; LPS induced TNF alpha factor; LPS-induced TNF-alpha factor; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276; p53 induced gene 7 protein; p53-induced gene 7 protein; PIG 7; PIG7; SIMPLE; Small integral membrane protein of lysosome/late endosome; TP53I7; Tumor protein p53 inducible protein 7;
Immunogens
Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
- Q99732 LITAF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99732 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y23 | Phosphorylation | Uniprot | |
S31 | Phosphorylation | Uniprot | |
Y32 | Phosphorylation | Uniprot | |
Y33 | Phosphorylation | Uniprot | |
K54 | Sumoylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
Y61 | Phosphorylation | Uniprot | |
Y62 | Phosphorylation | Uniprot | |
T63 | Phosphorylation | Uniprot | |
S105 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades. Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines. May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10.
Phosphorylated on tyrosine residues in response to EGF.
Cytoplasm. Nucleus. Lysosome membrane>Peripheral membrane protein>Cytoplasmic side. Early endosome membrane. Late endosome membrane. Endosome membrane>Peripheral membrane protein>Cytoplasmic side. Cell membrane>Peripheral membrane protein>Cytoplasmic side. Golgi apparatus membrane.
Note: Associated with membranes of lysosomes, early and late endosomes (PubMed:11274176, PubMed:27927196, PubMed:27582497). Can translocate from the cytoplasm into the nucleus (PubMed:15793005). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity).
Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
Monomer. Interacts with NEDD4. Interacts (via PSAP motif) with TSG101, a component of the ESCRT-I complex (endosomal sorting complex required for transport I). Interacts with WWOX. Interacts with STAM, a component of the ESCRT-0 complex; the interaction is direct. Identified in a complex with STAM and HGS; within this complex, interacts directly with STAM, but not with HGS. Interacts with STAT6.
The PPxY motif mediates interaction with WWOX and NEDD4.
The LITAF domain is stabilized by a bound zinc ion (PubMed:27927196, PubMed:27582497). The LITAF domain contains an amphiphatic helix that mediates interaction with lipid membranes (PubMed:23166352, PubMed:27927196, PubMed:27582497). It interacts specifically with phosphatidylethanolamine lipid headgroups, but not with phosphoglycerol, phosphocholine, phosphoserine or inositolhexakisphosphate (PubMed:27927196).
Belongs to the CDIP1/LITAF family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.