ERAB Antibody - #DF7347
| Product: | ERAB Antibody |
| Catalog: | DF7347 |
| Description: | Rabbit polyclonal antibody to ERAB |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 27kDa; 27kD(Calculated). |
| Uniprot: | Q99714 |
| RRID: | AB_2839285 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7347, RRID:AB_2839285.
Fold/Unfold
17 beta hydroxysteroid dehydrogenase 10; 17 beta hydroxysteroid dehydrogenase type 10; 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17b HSD10; 3 hydroxy 2 methylbutyryl CoA dehydrogenase; 3 hydroxyacyl CoA dehydrogenase type 2; 3 hydroxyacyl CoA dehydrogenase type II; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; AB binding alcohol dehydrogenase; ABAD; Ads9; Amyloid beta binding polypeptide; Amyloid beta peptide binding alcohol dehydrogenase; Amyloid beta peptide binding protein; Amyloid beta peptide binding protein; CAMR; DUPXp11.22; Endoplasmic Reticulum Amyloid Binding Protein; Endoplasmic reticulum associated amyloid beta peptide binding protein; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ER associated amyloid beta-binding protein; ERAB; HADH 2; HADH2; HCD 2; HCD2; HCD2_HUMAN; Hsd17b10; Hydroxyacyl CoA Dehydrogenase type II; Hydroxyacyl Coenzyme A dehydrogenase type II; Hydroxysteroid (17 beta) dehydrogenase 10; Mental retardation X linked syndromic 11; MHBD; Mitochondrial L3 Hydroxyacyl CoA Dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; MRPP2; MRX17; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5C member 1; Short chain L 3 hydroxyacyl CoA dehydrogenase type 2; Short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type 10 17b HSD; Type 10 17beta hydroxysteroid dehydrogenase; Type II HADH; XH98G2;
Immunogens
Ubiquitously expressed in normal tissues but is overexpressed in neurons affected in AD.
- Q99714 HCD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99714 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K9 | Ubiquitination | Uniprot | |
| S20 | Phosphorylation | Uniprot | |
| S36 | Phosphorylation | Uniprot | |
| S45 | Phosphorylation | Uniprot | |
| K52 | Acetylation | Uniprot | |
| K52 | Ubiquitination | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| K69 | Acetylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K79 | Acetylation | Uniprot | |
| K79 | Ubiquitination | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| K105 | Ubiquitination | Uniprot | |
| T153 | Phosphorylation | Uniprot | |
| T179 | Phosphorylation | Uniprot | |
| T203 | Phosphorylation | Uniprot | |
| T207 | Phosphorylation | Uniprot | |
| S208 | Phosphorylation | Uniprot | |
| C214 | S-Nitrosylation | Uniprot | |
| S219 | Phosphorylation | Uniprot | |
| R258 | Methylation | Uniprot |
Research Backgrounds
Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD). Essential for structural and functional integrity of mitochondria.
In addition to mitochondrial dehydrogenase activity, moonlights as a component of mitochondrial ribonuclease P, a complex that cleaves tRNA molecules in their 5'-ends. Together with HSD17B10/MRPP2, forms a subcomplex of the mitochondrial ribonuclease P, named MRPP1-MRPP2 subcomplex, which displays functions that are independent of the ribonuclease P activity. The MRPP1-MRPP2 subcomplex catalyzes the formation of N(1)-methylguanine and N(1)-methyladenine at position 9 (m1G9 and m1A9, respectively) in tRNAs; HSD17B10/MRPP2 acting as a non-catalytic subunit. The MRPP1-MRPP2 subcomplex also acts as a tRNA maturation platform: following 5'-end cleavage by the mitochondrial ribonuclease P complex, the MRPP1-MRPP2 subcomplex enhances the efficiency of 3'-processing catalyzed by ELAC2, retains the tRNA product after ELAC2 processing and presents the nascent tRNA to the mitochondrial CCA tRNA nucleotidyltransferase TRNT1 enzyme.
Mitochondrion.
Ubiquitously expressed in normal tissues but is overexpressed in neurons affected in AD.
Homotetramer. Component of mitochondrial ribonuclease P, a complex composed of TRMT10C/MRPP1, HSD17B10/MRPP2 and PRORP/MRPP3. Interacts with TRMT10C/MRPP1; forming the MRPP1-MRPP2 subcomplex of the mitochondrial ribonuclease P complex.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Metabolism > Amino acid metabolism > Valine, leucine and isoleucine degradation.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.