DBI Antibody - #DF7307
Product: | DBI Antibody |
Catalog: | DF7307 |
Description: | Rabbit polyclonal antibody to DBI |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 10kDa; 10kD(Calculated). |
Uniprot: | P07108 |
RRID: | AB_2839245 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7307, RRID:AB_2839245.
Fold/Unfold
ACBD 1; ACBD1; ACBP; ACBP_HUMAN; Acyl CoA binding domain containing 1; Acyl CoA binding protein; Acyl Coenzyme A binding domain containing 1; Acyl coenzyme A binding protein; Acyl-CoA-binding protein; CCK RP; CCKRP; Cholecystokinin releasing peptide trypsin sensitive; DBI; Diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator; MGC70414;
Immunogens
A synthesized peptide derived from human DBI, corresponding to a region within the internal amino acids.
Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
- P07108 ACBP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Endoplasmic reticulum. Golgi apparatus.
Note: Golgi localization is dependent on ligand binding (PubMed:17953517).
Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
Belongs to the ACBP family.
Research Fields
· Organismal Systems > Endocrine system > PPAR signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.