SDCBP Antibody - #DF7300
Product: | SDCBP Antibody |
Catalog: | DF7300 |
Description: | Rabbit polyclonal antibody to SDCBP |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 32kDa; 32kD(Calculated). |
Uniprot: | O00560 |
RRID: | AB_2839238 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7300, RRID:AB_2839238.
Fold/Unfold
MDA-9; MDA9; Melanoma differentiation-associated protein 9; Pro-TGF-alpha cytoplasmic domain-interacting protein 18; Scaffold protein Pbp1; SDCB1_HUMAN; SDCBP; ST1; SYCL; Syndecan binding protein (syntenin); Syndecan binding protein 1; Syndecan-binding protein 1; Syntenin 1; Syntenin-1; TACIP18;
Immunogens
Expressed in lung cancers, including adenocarcinoma, squamous cell carcinoma and small-cell carcinoma (at protein level) (PubMed:25893292). Widely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression in heart and placenta.
- O00560 SDCB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00560 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
Y4 | Phosphorylation | P12931 (SRC) | Uniprot |
S6 | Phosphorylation | O75385 (ULK1) | Uniprot |
K11 | Ubiquitination | Uniprot | |
K14 | Ubiquitination | Uniprot | |
S33 | Phosphorylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
Y46 | Phosphorylation | Uniprot | |
Y50 | Phosphorylation | Uniprot | |
S54 | Phosphorylation | Uniprot | |
Y56 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
Y91 | Phosphorylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K124 | Ubiquitination | Uniprot | |
S131 | Phosphorylation | Uniprot | |
K173 | Ubiquitination | Uniprot | |
K179 | Ubiquitination | Uniprot | |
K185 | Ubiquitination | Uniprot | |
K223 | Ubiquitination | Uniprot | |
S285 | Phosphorylation | Uniprot |
Research Backgrounds
Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis. Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1. In concert with SDC1/4 and PDCD6IP, regulates exosome biogenesis. Regulates migration, growth, proliferation, and cell cycle progression in a variety of cancer types. In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). May also play a role in vesicular trafficking. Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway.
Phosphorylated on tyrosine residues.
Cell junction>Focal adhesion. Cell junction>Adherens junction. Cell membrane>Peripheral membrane protein. Endoplasmic reticulum membrane>Peripheral membrane protein. Nucleus. Melanosome. Cytoplasm>Cytosol. Cytoplasm>Cytoskeleton. Secreted>Extracellular exosome. Membrane raft.
Note: Mainly membrane-associated. Localized to adherens junctions, focal adhesions and endoplasmic reticulum. Colocalized with actin stress fibers. Also found in the nucleus. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Associated to the plasma membrane in the presence of FZD7 and phosphatidylinositol 4,5-bisphosphate (PIP2) (PubMed:27386966).
Expressed in lung cancers, including adenocarcinoma, squamous cell carcinoma and small-cell carcinoma (at protein level). Widely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression in heart and placenta.
Monomer and homodimer (By similarity). Interacts with SDC1, SDC2, SDC3, SDC4, NRXN2, EPHA7, EPHB1, NF2 isoform 1, TGFA and IL5RA. Interacts with NFASC and PTPRJ (By similarity). Interacts with SDCBP2. Interacts with PDCD6IP. Forms a complex with PDCD6IP and SDC2. Interacts (via C-terminus) with TGFBR1. Binds to FZD7; this interaction is increased by inositol trisphosphate (IP3). Interacts with SMO (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.