PSME1 Antibody - #DF7298
Product: | PSME1 Antibody |
Catalog: | DF7298 |
Description: | Rabbit polyclonal antibody to PSME1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit |
Mol.Wt.: | 28kDa; 29kD(Calculated). |
Uniprot: | Q06323 |
RRID: | AB_2839237 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7298, RRID:AB_2839237.
Fold/Unfold
11S regulator complex alpha subunit; 11S regulator complex subunit alpha; 29 kD MCP activator subunit; 29kD MCP activator subunit; Activator of multicatalytic protease subunit 1; IFI5111; IGUP I-5111; Interferon gamma IEF SSP 5111; Interferon gamma inducible protein 5111; Interferon gamma up regulated I 5111 protein; Interferon gamma up-regulated I-5111 protein; MGC8628; PA28a; PA28alpha; Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha); Proteasome activator 28 subunit alpha; Proteasome activator complex subunit 1; Proteasome activator subunit 1; PSME1; PSME1_HUMAN; REG-alpha; REGalpha;
Immunogens
- Q06323 PSME1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q06323 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K13 | Acetylation | Uniprot | |
K13 | Ubiquitination | Uniprot | |
T23 | Phosphorylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
T25 | Phosphorylation | Uniprot | |
S31 | Phosphorylation | Uniprot | |
K35 | Acetylation | Uniprot | |
K35 | Ubiquitination | Uniprot | |
K36 | Ubiquitination | Uniprot | |
S38 | Phosphorylation | Uniprot | |
K45 | Ubiquitination | Uniprot | |
S55 | Phosphorylation | Uniprot | |
K58 | Sumoylation | Uniprot | |
K58 | Ubiquitination | Uniprot | |
K90 | Acetylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot | |
S175 | Phosphorylation | Uniprot | |
K176 | Ubiquitination | Uniprot | |
K187 | Ubiquitination | Uniprot | |
K190 | Ubiquitination | Uniprot | |
Y209 | Phosphorylation | Uniprot | |
R213 | Methylation | Uniprot | |
R220 | Methylation | Uniprot | |
K232 | Acetylation | Uniprot | |
K245 | Ubiquitination | Uniprot | |
Y249 | Phosphorylation | Uniprot |
Research Backgrounds
Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
Heterodimer of PSME1 and PSME2, which forms a hexameric ring. PSME1 can form homoheptamers.
Belongs to the PA28 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.