GTF2A1 Antibody - #DF7287
| Product: | GTF2A1 Antibody | 
| Catalog: | DF7287 | 
| Description: | Rabbit polyclonal antibody to GTF2A1 | 
| Application: | WB IHC IF/ICC | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus | 
| Mol.Wt.: | 19kDa, 40 kDa; 42kD(Calculated). | 
| Uniprot: | P52655 | 
| RRID: | AB_2839226 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7287, RRID:AB_2839226.
Fold/Unfold
General transcription factor IIA 1 19/37kDa; General transcription factor IIA subunit 1; General transcription factor IIA1; Glucose regulated protein 58kD pseudogene; gtf2a1; TF2A1; TF2AA_HUMAN; TFIIA 42; TFIIA alpha p55; TFIIA alpha p55, isoform 1; TFIIA p19 subunit; TFIIA p35 subunit; TFIIA-42; TFIIAL; Transcription initiation factor IIA beta chain; Transcription initiation factor IIA subunit 1; Transcription initiation factor TFIIA 42 kDa subunit;
Immunogens
A synthesized peptide derived from human GTF2A1, corresponding to a region within the internal amino acids.
- P52655 TF2AA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
The alpha and beta subunits are postranslationally produced from the precursor form by TASP1. The cleavage promotes proteasomal degradation.
Nucleus. 
Belongs to the TFIIA subunit 1 family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											 
											