KLKB1 Antibody - #DF7271
Product: | KLKB1 Antibody |
Catalog: | DF7271 |
Description: | Rabbit polyclonal antibody to KLKB1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 71kDa; 71kD(Calculated). |
Uniprot: | P03952 |
RRID: | AB_2839210 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7271, RRID:AB_2839210.
Fold/Unfold
Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B, plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein;
Immunogens
- P03952 KLKB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P03952 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N127 | N-Glycosylation | Uniprot | |
T275 | Phosphorylation | Uniprot | |
N308 | N-Glycosylation | Uniprot | |
N396 | N-Glycosylation | Uniprot | |
N453 | N-Glycosylation | Uniprot | |
N494 | N-Glycosylation | Uniprot | |
R604 | Methylation | Uniprot | |
R605 | Methylation | Uniprot |
Research Backgrounds
The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Secreted.
Forms a heterodimer with SERPINA5. The zymogen is activated by factor XIIa, which cleaves the molecule into a light chain, which contains the active site, and a heavy chain, which associates with HMW kininogen. These chains are linked by one or more disulfide bonds.
Belongs to the peptidase S1 family. Plasma kallikrein subfamily.
Research Fields
· Organismal Systems > Immune system > Complement and coagulation cascades. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.