ERCC1 Antibody - #DF7255
Product: | ERCC1 Antibody |
Catalog: | DF7255 |
Description: | Rabbit polyclonal antibody to ERCC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 33kDa; 33kD(Calculated). |
Uniprot: | P07992 |
RRID: | AB_2839194 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7255, RRID:AB_2839194.
Fold/Unfold
COFS 4; COFS4; DNA excision repair protein ERCC 1; DNA excision repair protein ERCC-1; DNA excision repair protein ERCC1; ERCC 1; ERCC1; ERCC1_HUMAN; Excision repair cross complementation group 1; Excision repair cross complementing 1; Excision Repair Cross Complementing Rodent Repair Deficiency Complementation Group 1; Excision repair protein; RAD 10; RAD10; UV 20; UV20;
Immunogens
- P07992 ERCC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P07992 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Ubiquitination | Uniprot | ||
M1 | Acetylation | Uniprot | |
S14 | Phosphorylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
K37 | Acetylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
S104 | Phosphorylation | Uniprot | |
K114 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
K213 | Ubiquitination | Uniprot | |
K226 | Ubiquitination | Uniprot | |
K243 | Ubiquitination | Uniprot | |
K247 | Ubiquitination | Uniprot | |
K281 | Ubiquitination | Uniprot | |
K295 | Acetylation | Uniprot | |
K295 | Ubiquitination | Uniprot |
Research Backgrounds
Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.
Nucleus.
Cytoplasm. Nucleus.
Nucleus.
Nucleus.
Heterodimer composed of ERCC1 isoform 1 and XPF/ERRC4.
Belongs to the ERCC1/RAD10/SWI10 family.
Research Fields
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
· Genetic Information Processing > Replication and repair > Fanconi anemia pathway.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.