Product: SUMO4 Antibody
Catalog: DF7186
Description: Rabbit polyclonal antibody to SUMO4
Application: WB IHC
Reactivity: Human, Mouse, Rat, Monkey
Mol.Wt.: 12kDa; 11kD(Calculated).
Uniprot: Q6EEV6
RRID: AB_2839138

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-1:2000, IHC 1:100-1:300
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Clonality:
Polyclonal
Specificity:
SUMO4 Antibody detects endogenous levels of total SUMO4.
RRID:
AB_2839138
Cite Format: Affinity Biosciences Cat# DF7186, RRID:AB_2839138.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q6EEV6 SUMO4_HUMAN:

Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.

Description:
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.
Sequence:
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

PTMs - Q6EEV6 As Substrate

Site PTM Type Enzyme
K11 Sumoylation
K21 Ubiquitination
S28 Phosphorylation
K33 Acetylation
K33 Methylation
K33 Sumoylation
K33 Ubiquitination
K35 Ubiquitination

Research Backgrounds

Function:

Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.

PTMs:

In contrast to SUMO1, SUMO2 and SUMO3, seems to be insensitive to sentrin-specific proteases due to the presence of Pro-90. This may impair processing to mature form and conjugation to substrates.

Tissue Specificity:

Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.

Subunit Structure:

Interacts with SAE2. Covalently attached to a number of proteins (Probable).

Family&Domains:

Belongs to the ubiquitin family. SUMO subfamily.

Research Fields

· Genetic Information Processing > Translation > RNA transport.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.