SUMO4 Antibody - #DF7186
Product: | SUMO4 Antibody |
Catalog: | DF7186 |
Description: | Rabbit polyclonal antibody to SUMO4 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Mol.Wt.: | 12kDa; 11kD(Calculated). |
Uniprot: | Q6EEV6 |
RRID: | AB_2839138 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7186, RRID:AB_2839138.
Fold/Unfold
dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN;
Immunogens
Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
- Q6EEV6 SUMO4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
PTMs - Q6EEV6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K11 | Sumoylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
S28 | Phosphorylation | Uniprot | |
K33 | Acetylation | Uniprot | |
K33 | Methylation | Uniprot | |
K33 | Sumoylation | Uniprot | |
K33 | Ubiquitination | Uniprot | |
K35 | Ubiquitination | Uniprot |
Research Backgrounds
Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
In contrast to SUMO1, SUMO2 and SUMO3, seems to be insensitive to sentrin-specific proteases due to the presence of Pro-90. This may impair processing to mature form and conjugation to substrates.
Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
Interacts with SAE2. Covalently attached to a number of proteins (Probable).
Belongs to the ubiquitin family. SUMO subfamily.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.