SUMO3 Antibody | Affinity Biosciences

1/1

Western blot analysis of extracts from MCF7 , using SUMO3 antibody.

Product:	SUMO3 Antibody
Catalog:	DF7185
Description:	Rabbit polyclonal antibody to SUMO3
Application:	WB IHC
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	12kDa; 12kD(Calculated).
Uniprot:	P55854
RRID:	AB_2839137

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:1000-1:2000, IHC 1:100-1:300
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

SUMO3 Antibody detects endogenous levels of total SUMO3.

RRID:

AB_2839137
Cite Format: Affinity Biosciences Cat# DF7185, RRID:AB_2839137.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Small ubiquitin like modifier 3; Small ubiquitin related modifier 3; Small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3; SMT3, yeast, homolog 1; SMT3A; Smt3B; SMT3H1; SUMO-2; SUMO-3; sumo3; SUMO3_HUMAN; Ubiquitin like protein SMT3A; Ubiquitin-like protein SMT3B;

Immunogens

Immunogen:

Uniprot:

P55854(SUMO3_HUMAN) >>Visit HPA database.

Gene(ID):

SUMO3(6612)

Expression:

P55854 SUMO3_HUMAN:

Expressed predominantly in liver.

Description:

Small ubiquitin-related modifier 1, 2 and 3 (SUMO-1, -2 and -3) are members of the ubiquitin-like protein family (1). The covalent attachment of the SUMO-1, -2 or -3 (SUMOylation) to target proteins is analogous to ubiquitination. This post-translational modification is a reversible, multi-step process that is initiated by cleaving a precursor protein to a mature protein. Mature SUMO-1, -2 or -3 is then linked to the activating enzyme E1, conjugated to E2 and in conjunction with E3, SUMO-1, -2 or -3 is ligated to the target protein (2). Ubiquitin and the individual SUMO family members are all targeted to different proteins with diverse biological functions. Ubiquitin predominantly regulates degradation of its target (1). In contrast, SUMO-1 is conjugated to RanGAP, PML, p53 and IκB-α to regulate nuclear trafficking, formation of subnuclear structures, regulation of transcriptional activity and protein stability (3-7). SUMO-2/-3 forms poly-(SUMO) chains, is conjugated to topoisomerase II and APP, regulates chromosomal segregation and cellular responses to environmental stress, and plays a role in the progression of Alzheimer disease (8-11).

Sequence:

P55854 SUMO3_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

PTMs - P55854 As Substrate

P55854

Site	PTM Type	Source
S2	Phosphorylation	Uniprot
K5	Ubiquitination	Uniprot
K7	Sumoylation	Uniprot
K7	Ubiquitination	Uniprot
K11	Acetylation	Uniprot
K11	Sumoylation	Uniprot
K11	Ubiquitination	Uniprot
T12	Phosphorylation	Uniprot
K20	Ubiquitination	Uniprot
S27	Phosphorylation	Uniprot
K32	Acetylation	Uniprot
K32	Methylation	Uniprot
K32	Sumoylation	Uniprot
K32	Ubiquitination	Uniprot
K34	Ubiquitination	Uniprot
T37	Phosphorylation	Uniprot
K41	Acetylation	Uniprot
K41	Sumoylation	Uniprot
K41	Ubiquitination	Uniprot
K44	Acetylation	Uniprot
K44	Methylation	Uniprot
K44	Sumoylation	Uniprot
K44	Ubiquitination	Uniprot
R49	Methylation	Uniprot
S53	Phosphorylation	Uniprot

Research Backgrounds

P55854_SUMO3_HUMAN

Function:

Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX.

PTMs:

Polymeric chains can be formed through Lys-11 cross-linking.

Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.

Subcellular Location:

Cytoplasm. Nucleus. Nucleus>PML body.

Tissue Specificity:

Expressed predominantly in liver.

Subunit Structure:

Covalently attached to a number of proteins. Interacts with ARNTL/BMAL1 (By similarity). Interacts with USP25 (via ts SIM domain); the interaction sumoylates USP25 and inhibits its ubiquitin hydrolyzing activity. Interacts with SAE2 and UBE2I.

Family&Domains:

Belongs to the ubiquitin family. SUMO subfamily.

Research Fields

· Genetic Information Processing > Translation > RNA transport.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

SUMO3 Antibody - #DF7185