Product: PDX1 Antibody
Catalog: DF7170
Description: Rabbit polyclonal antibody to PDX1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 31kDa; 31kD(Calculated).
Uniprot: P52945
RRID: AB_2839122

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:100
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(86%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(86%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
PDX1 Antibody detects endogenous levels of total PDX1.
RRID:
AB_2839122
Cite Format: Affinity Biosciences Cat# DF7170, RRID:AB_2839122.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Glucose sensitive factor; Glucose-sensitive factor; GSF; IDX 1; IDX-1; IDX1; Insulin promoter factor 1; Insulin promoter factor 1 homeodomain transcription factor; Insulin upstream factor 1; IPF 1; IPF-1; IPF1; Islet/duodenum homeobox 1; Islet/duodenum homeobox-1; IUF 1; IUF-1; IUF1; MODY4; Pancreas/duodenum homeobox 1; Pancreas/duodenum homeobox protein 1; pancreatic and duodenal homeobox P; PDX 1; PDX-1; PDX1; PDX1_HUMAN; Somatostatin transactivating factor 1; Somatostatin-transactivating factor 1; STF 1; STF-1; STF1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P52945 PDX1_HUMAN:

Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).

Description:
The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
Sequence:
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Rabbit
100
Pig
86
Chicken
86
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P52945 As Substrate

Site PTM Type Enzyme
T11 Phosphorylation P78527 (PRKDC)
S61 Phosphorylation Q16539 (MAPK14) , P28482 (MAPK1) , P45984 (MAPK9)
S66 Phosphorylation Q16539 (MAPK14) , P45984 (MAPK9) , P28482 (MAPK1)
T151 Phosphorylation Q96RG2 (PASK)
S268 Phosphorylation Q9H2X6 (HIPK2)
S272 Phosphorylation

Research Backgrounds

Function:

Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell.

PTMs:

Phosphorylated by the SAPK2 pathway at high intracellular glucose concentration. Phosphorylated by HIPK2 on Ser-268 upon glucose accumulation. This phosphorylation mediates subnuclear localization shifting. Phosphorylation by PASK may lead to translocation into the cytosol (By similarity).

Subcellular Location:

Nucleus. Cytoplasm>Cytosol.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).

Subunit Structure:

Interacts with the basic helix-loop-helix domains of TCF3(E47) and NEUROD1 and with HMG-I(Y). Interacts with SPOP (By similarity). Interacts with the methyltransferase SETD7. Part of a PDX1:PBX1b:MEIS2b complex.

Family&Domains:

The Antp-type hexapeptide mediates heterodimerization with PBX on a regulatory element of the somatostatin promoter.

The homeodomain, which contains the nuclear localization signal, not only mediates DNA-binding, but also acts as a protein-protein interaction domain for TCF3(E47), NEUROD1 and HMG-I(Y).

Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Type II diabetes mellitus.

· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

References

1). Sall2 knockdown exacerbates palmitic acid induced dysfunction and apoptosis of pancreatic NIT-1 beta cells. BIOMEDICINE & PHARMACOTHERAPY, 2018 (PubMed: 29783189) [IF=7.5]

Application: WB    Species: mouse    Sample: NIT-1-shc and NIT-1-sh2 cells

Fig. 4.| Sall2 knockdown impaired insulin synthesis and secretion in NIT-1 cell. NIT-1-sh2 cells and NIT-1-shc cells were incubated with or without 0.5 mM PA for 48 h. (A) GSIS was performed in NIT-1-shc cells and NIT-1-sh2 cells. (B) Pdx-1, MafA, Ins1, and Ins2 mRNA levels in NIT-1-shc and NIT-1-sh2 cells. (C)Western blot analysis of Sall2 and Pdx-1 expression levels in NIT-1-shc and NIT-1-sh2 cells. Data represent mean ± SD of three independent experiments. *p < 0.05,**p < 0.01, ***p < 0.001.

2). A New Way for Beta Cell Neogenesis: Transdifferentiation from Alpha Cells Induced by Glucagon-Like Peptide 1. Journal of Diabetes Research, 2019 (PubMed: 31001561) [IF=4.3]

Application: WB    Species: rat    Sample: islets

Figure 5: | Western blotting analysis for Akt, FoxO1, Pdx1, MafA, and MafB in rat islets. GAPDH was used as a loading control (#P < 0 05 vs.NC; ∗P < 0 05 vs. DM; •P < 0 05 vs. GLP1 50 μg/kg; and ΔP < 0 05 vs. GLP1 100 μg/kg). GLP1, glucagon-like peptide 1; NC, negative control;DM, diabetes mellitus; Akt, AKT kinase; FoxO1, forkhead box O 1; Pdx1, pancreatic and duodenal homeobox 1; MafA, MAF BZIP transcription factor A; MafB, MAF BZIP transcription factor B; GAPDH, glyceraldehyde-3-phosphate dehydrogenase.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.