KLK2 Antibody - #DF7136
Product: | KLK2 Antibody |
Catalog: | DF7136 |
Description: | Rabbit polyclonal antibody to KLK2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 29kDa; 29kD(Calculated). |
Uniprot: | P20151 |
RRID: | AB_2839090 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7136, RRID:AB_2839090.
Fold/Unfold
Glandular kallikrein 2; Glandular kallikrein-1; hGK 1; hGK-1; hK2; Kallikrein 2 prostatic; Kallikrein related peptidase 2; kallikrein, glandular; Kallikrein, prostatic; Kallikrein-2; KLK 2; Klk-2; Klk2; KLK2_HUMAN; KLK2A 2; KLK2A2; MGC12201; Tissue kallikrein 2; Tissue kallikrein-2; Ton;
Immunogens
- P20151 KLK2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
PTMs - P20151 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y101 | Phosphorylation | Uniprot | |
S104 | Phosphorylation | Uniprot |
Research Backgrounds
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Belongs to the peptidase S1 family. Kallikrein subfamily.
Research Fields
· Organismal Systems > Endocrine system > Renin-angiotensin system. (View pathway)
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.