CX3CR1 Antibody - #DF7096
| Product: | CX3CR1 Antibody |
| Catalog: | DF7096 |
| Description: | Rabbit polyclonal antibody to CX3CR1 |
| Application: | WB IF/ICC |
| Cited expt.: | WB, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 44kDa; 40kD(Calculated). |
| Uniprot: | P49238 |
| RRID: | AB_2839051 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7096, RRID:AB_2839051.
Fold/Unfold
Beta chemokine receptor-like 1; C X3 C CKR 1; C-X3-C CKR-1; CCRL1; Chemokine C X3 C motif receptor 1; CMK BRL 1; CMK-BRL-1; CMK-BRL1; CMKBLR1; CMKDR1; CX3C chemokine receptor 1; CX3C CKR1; CX3C1_HUMAN; CX3CR1; Fractalkine receptor; G-protein coupled receptor 13; GPR13; GPRV28; V28;
Immunogens
A synthesized peptide derived from human CX3CR1, corresponding to a region within N-terminal amino acids.
- P49238 CX3C1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Research Backgrounds
Receptor for the CX3C chemokine fractalkine (CX3CL1); binds to CX3CL1 and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.
This protein is not N-glycosylated which is unusual for G-protein-coupled receptors.
Cell membrane>Multi-pass membrane protein.
Expressed in lymphoid and neural tissues.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
References
Application: WB Species: human Sample: OSCC cell
Application: IF/ICC Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.