SLC18A2 Antibody - #DF7087

Product: | SLC18A2 Antibody |
Catalog: | DF7087 |
Description: | Rabbit polyclonal antibody to SLC18A2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 55kDa; 56kD(Calculated). |
Uniprot: | Q05940 |
RRID: | AB_2839043 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7087, RRID:AB_2839043.
Fold/Unfold
1110037L13Rik; 9330105E13; MGC120477; MGC120478; MGC26538; MGC90556; MNAT; Monoamine neurotransmitter transporter; Monoamine transporter; OTTHUMP00000020576; SLC18A2; Solute carrier family 18 (vesicular monoamine) member 2; Solute carrier family 18 member 2; SVAT; SVMT; Synaptic vesicle amine transporter brain; Synaptic vesicle monoamine transporter brain; Synaptic vesicular amine transporter; VAT 2; VAT2; Vesicle monoamine transporter type 2; Vesicle monoamine/H+ antiporter; Vesicular amine transporter 2; Vesicular monoamine transporter 2; VMAT 2; VMAT2; VMAT2_HUMAN;
Immunogens
- Q05940 VMAT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q05940 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S15 | Phosphorylation | P17252 (PRKCA) | Uniprot |
S18 | Phosphorylation | P17252 (PRKCA) | Uniprot |
S240 | Phosphorylation | Uniprot | |
S279 | Phosphorylation | Uniprot | |
T283 | Phosphorylation | Uniprot | |
T286 | Phosphorylation | Uniprot | |
T287 | Phosphorylation | Uniprot | |
S511 | Phosphorylation | Uniprot | |
S513 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Cytoplasmic vesicle membrane>Multi-pass membrane protein.
Interacts with SLC6A3.
Belongs to the major facilitator superfamily. Vesicular transporter family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Substance dependence > Cocaine addiction.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Human Diseases > Substance dependence > Alcoholism.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Nervous system > Serotonergic synapse.
· Organismal Systems > Nervous system > Dopaminergic synapse.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.