Product: FBXO32 Antibody
Catalog: DF7075
Description: Rabbit polyclonal antibody to FBXO32
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 40kDa; 42kD(Calculated).
Uniprot: Q969P5
RRID: AB_2839031

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:100
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
FBXO32 Antibody detects endogenous levels of total FBXO32.
RRID:
AB_2839031
Cite Format: Affinity Biosciences Cat# DF7075, RRID:AB_2839031.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4833442G10Rik; AI430017; Atrogin 1; Atrogin-1; ATROGIN1; Atrophy gene 1; F box only protein 32; F-box only protein 32; F-box protein 32; FBX32_HUMAN; fbxo25; FBXO32; FLJ32424; MAFbx; MGC108443; MGC137646; MGC33610; Muscle atrophy F box; Muscle atrophy F box protein; Muscle atrophy F-box protein;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q969P5 FBX32_HUMAN:

Specifically expressed in cardiac and skeletal muscle.

Description:
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Sequence:
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
73
Xenopus
64
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q969P5 As Substrate

Site PTM Type Enzyme
K29 Ubiquitination
S30 Phosphorylation
S32 Phosphorylation
K48 Ubiquitination
K82 Ubiquitination
S260 Phosphorylation
K268 Ubiquitination
T333 Phosphorylation
S345 Phosphorylation

Research Backgrounds

Function:

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Shuttles between cytoplasm and the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Specifically expressed in cardiac and skeletal muscle.

Subunit Structure:

Part of the SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complex SCF(FBXO32) formed of CUL1, SKP1, RBX1 and FBXO32.

Research Fields

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

References

1). Fucoxanthin rescues dexamethasone induced C2C12 myotubes atrophy. BIOMEDICINE & PHARMACOTHERAPY, 2021 (PubMed: 33865017) [IF=7.5]

Application: WB    Species: Mouse    Sample: C2C12 cell

Fig. 1. Fucoxanthin protects C2C12 myotubes against dexamethasone-induced atrophy. (A) Cell viability of C2C12 cells in different concentrations of fucoxanthin (0 μM, 1 μM, 5 μM,10 μM and 100 μM) and dexamethasone (10 μM). (B and C) Western blot and quantification of MyHC, Atrogin-1 and MuRF1. Ctrl = control group, DEX = dexamethasone (10 μM) treatment group, DEX + FX = dexamethasone(10 μM) combined with fucoxanthin(10 μM) treatment group. All expression was normalized to that of the control group. #P < 0.05 vs. the control group, &P < 0.05 vs. the DEX group.

2). Spinal Irisin Gene Delivery Attenuates Burn Injury-Induced Muscle Atrophy by Promoting Axonal Myelination and Innervation of Neuromuscular Junctions. International Journal of Molecular Sciences, 2022 (PubMed: 36555538) [IF=5.6]

Application: IF/ICC    Species: Human    Sample:

Figure 2 Spinal irisin gene delivery attenuated burn injury-induced atrophy markers and reduced irisin and SMN expression in ipsilateral gastrocnemius muscle. (A) Immunofluorescence staining of atrogin-1 and MuRF in ipsilateral gastrocnemius muscle in the fourth week after burn injury. DAPI counterstain was used to locate the nucleus. (B,C) Representative bar graphs illustrating averaged optical intensity of atrogin-1 and MuRF. Error bars represent standard deviations (SDs). ** p < 0.01, *** p < 0.001, unpaired t-test. (D) Immunoblot of ipsilateral gastrocnemius muscle tissue in the fourth week after burn injury. (E–H) Representative bar graphs illustrating normalized expression ratio of irisin, atrogin-1, MuRF, and SMN, with GAPDH as an internal control. Error bars represent SDs. * p < 0.05, ** p < 0.01, unpaired t-test.

Application: WB    Species: Human    Sample:

Figure 2 Spinal irisin gene delivery attenuated burn injury-induced atrophy markers and reduced irisin and SMN expression in ipsilateral gastrocnemius muscle. (A) Immunofluorescence staining of atrogin-1 and MuRF in ipsilateral gastrocnemius muscle in the fourth week after burn injury. DAPI counterstain was used to locate the nucleus. (B,C) Representative bar graphs illustrating averaged optical intensity of atrogin-1 and MuRF. Error bars represent standard deviations (SDs). ** p < 0.01, *** p < 0.001, unpaired t-test. (D) Immunoblot of ipsilateral gastrocnemius muscle tissue in the fourth week after burn injury. (E–H) Representative bar graphs illustrating normalized expression ratio of irisin, atrogin-1, MuRF, and SMN, with GAPDH as an internal control. Error bars represent SDs. * p < 0.05, ** p < 0.01, unpaired t-test.

3). Calycosin inhibited autophagy and oxidative stress in chronic kidney disease skeletal muscle atrophy by regulating AMPK/SKP2/CARM1 signalling pathway. JOURNAL OF CELLULAR AND MOLECULAR MEDICINE, 2020 (PubMed: 32910538) [IF=5.3]

Application: IHC    Species: rat    Sample: muscles

FIGURE 2|Effect of calycosin on muscle histology, apoptosis, and MuRF1 and MAFbx expression levels in muscle of 5/6 Nx rats. A, Representative images of H&E stained rat muscles (200x). B-E, Representative images and scores of IHC staining of MuRF1 and MAFbx in rat muscles (×200). Bar = 50 µm. *P < 0.05 compared to the sham group. ##P < 0.01 compared to the 5/6 Nx model group

Application: WB    Species: rat    Sample: muscles

FIGURE 5|Effect of calycosin on the expression of CARM1 and H3R17me2a,and related proteins in rat muscles. A-B,Representative images and scores of the expression of CARM1 and H3R17me2a in muscle sections using IHC staining (×200).Bar = 50 µm. *P < 0.05 compared to the sham group. ##P < 0.01 compared to the 5/6 Nx model group. C-E, Representative immune blots of key proteins involved in muscle atrophy and proteins associated with the AMPK/SKP2/CARM1 signalling pathway

4). Differential Gene Expression Patterns Between Apical and Basal Inner Hair Cells Revealed by RNA-Seq. Frontiers in Molecular Neuroscience, 2020 (PubMed: 32038162) [IF=4.8]

Application: IHC    Species: mouse    Sample: basal and apical IHCs

FIGURE 8 | Validation of expression of representative genes using immunohistochemistry. Overviews of DAB-immunohistochemical staining of OCM, PVALB,FBXO32, and SNCG and the representative images of the apical and basal regions indicated by the box in (A–D) were showed. Red asterisks indicate IHCs and black asterisks indicate OHCs in all panels. OCM (A) was highly expressed in OHCs while PVALB (B) and FBXO32 (C) expressed higher in basal than apical IHCs.

5). Kcnma1 is involved in mitochondrial homeostasis in diabetes-related skeletal muscle atrophy. The FASEB Journal, 2023 (PubMed: 36929614) [IF=4.8]

6). Erythropoietin Alleviates Burn-induced Muscle Wasting. International Journal of Medical Sciences, 2020 (PubMed: 31929736) [IF=3.6]

Application: WB    Species: rat    Sample: gastrocnemius

Figure 1. |EPO on burn-induced muscle fiber atrophy and atrophy-related ubiquitin ligase, atrogin-1 (A) Representative H&E staining of gastrocnemius muscle section (200x). Average myofiber cross-sectional area of 4 groups. (B) Representative western blot of atrogin-1. EPO decreased the elevation of atrogin-1 post-burn.

7). Metformin ameliorates skeletal muscle atrophy in Grx1 KO mice by regulating intramuscular lipid accumulation and glucose utilization. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, 2020 (PubMed: 33069361) [IF=3.1]

Application: WB    Species: mouse    Sample:

Fig. 2.| Skeletal muscle atrophy induced by Grx1 KO was alleviated by Metformin. (J ~ L) mRNA and protein levels of Trim63 and Fbxo32. GAPDH was used as control, all expression was normalized to that of the control group. Data were expressed as means ± SEM. n ¼ 5 per group; *P < 0.05. (For interpretation of the references to colour in this figure legend, the reader is referred to the Web version of this article.)

8). Metformin attenuates angiotensin II‑induced cardiomyocyte hypertrophy by upregulating the MuRF1 and MAFbx pathway. Experimental and Therapeutic Medicine, 2021 (PubMed: 34539827) [IF=2.7]

Application: WB    Species: Rat    Sample: H9c2 cells

Figure 3 Effects of metformin on MuRF1 and MAFbx expression. (A) Western blot analysis measuring the expression of MuRF1 and MAFbx protein after the indicated treatments. (B) Densitometric analysis of MuRF1 and MAFbx expression in cardiomyocytes. n=3 for each group. *P<0.05. #P<0.05. MuRF1, muscle RING-finger protein-1; MAFbx, muscle atrophy F-box; Ang, angiotensin; Met, metformin.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.