NRG4 Antibody - #DF7046
Product: | NRG4 Antibody |
Catalog: | DF7046 |
Description: | Rabbit polyclonal antibody to NRG4 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Sheep |
Mol.Wt.: | 12kDa; 13kD(Calculated). |
Uniprot: | Q8WWG1 |
RRID: | AB_2839002 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7046, RRID:AB_2839002.
Fold/Unfold
DKFZp779N0541; DKFZp779N1944; Heregulin 4; HRG4; Neuregulin 4; Neuregulin-4; NRG-4; NRG4; NRG4_HUMAN; pro-neuregulin-4, membrane-bound isoform; Pro-NRG4;
Immunogens
- Q8WWG1 NRG4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors (By similarity).
Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
Extensive glycosylation precedes the proteolytic cleavage.
Cell membrane>Single-pass type I membrane protein.
Note: Does not seem to be active.
Secreted.
Interacts with ERBB4.
The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).
ERBB receptor binding is elicited entirely by the EGF-like domain.
Belongs to the neuregulin family.
Research Fields
· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.