CCL28 Antibody - #DF7045
![](/images/pubmed.gif)
Product: | CCL28 Antibody |
Catalog: | DF7045 |
Description: | Rabbit polyclonal antibody to CCL28 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 14kDa; 14kD(Calculated). |
Uniprot: | Q9NRJ3 |
RRID: | AB_2839001 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7045, RRID:AB_2839001.
Fold/Unfold
C C motif chemokine ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK 1; CCK1; CCK1 protein; CCL 28; CCL28; CCL28_HUMAN; Chemokine (C-C motif) ligand 28; chemokine (C-C motif) ligand 28 splice variant chi; MEC; Mucosae associated epithelial chemokine; Mucosae-associated epithelial chemokine; Protein CCK1; SCYA28; Small inducible cytokine A28 [Precursor]; small inducible cytokine subfamily A (Cys-Cys), member 28; Small-inducible cytokine A28;
Immunogens
Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
- Q9NRJ3 CCL28_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
PTMs - Q9NRJ3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K92 | Acetylation | Uniprot | |
K95 | Acetylation | Uniprot |
Research Backgrounds
Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
Secreted.
Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
· Organismal Systems > Immune system > Intestinal immune network for IgA production. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.