BTC Antibody - #DF7038
Product: | BTC Antibody |
Catalog: | DF7038 |
Description: | Rabbit polyclonal antibody to BTC |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 20kDa; 20kD(Calculated). |
Uniprot: | P35070 |
RRID: | AB_2838994 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7038, RRID:AB_2838994.
Fold/Unfold
Betacellulin; Betacellulin precursor; BTC; BTC_HUMAN; OTTHUMP00000160600; OTTHUMP00000219057; Probetacellulin;
Immunogens
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
- P35070 BTC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Secreted>Extracellular space.
Cell membrane>Single-pass type I membrane protein.
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
Monomer. Interacts with EGFR and ERBB4.
Research Fields
· Environmental Information Processing > Signal transduction > ErbB signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.