PRG2 Antibody - #DF6992

(1)   (2)  
Product: PRG2 Antibody
Catalog: DF6992
Description: Rabbit polyclonal antibody to PRG2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 25kDa; 25kD(Calculated).
Uniprot: P13727
RRID: AB_2838948

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
PRG2 Antibody detects endogenous levels of total PRG2.
RRID:
AB_2838948
Cite Format: Affinity Biosciences Cat# DF6992, RRID:AB_2838948.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BMPG; Bone marrow proteoglycan; EMBP; Eosinophil granule major basic protein; Eosinophil major basic protein; MBP; MBP1; MGC14537; Natural killer cell activator; Pregnancy associated major basic protein; Pregnancy-associated major basic protein; PRG 2; PRG2; PRG2_HUMAN; Proteoglycan 2; Proteoglycan 2 bone marrow; Proteoglycan 2 preproprotein; Proteoglycan2;

Immunogens

Immunogen:
Uniprot:

P13727(PRG2_HUMAN) >>Visit HPA database.

Gene(ID):
PRG2(5553)
Expression:
P13727 PRG2_HUMAN:

High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Description:
The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Sequence:
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

PTMs - P13727 As Substrate

Site PTM Type Enzyme
T23 O-Glycosylation
S24 O-Glycosylation
T25 O-Glycosylation
T34 O-Glycosylation
S62 O-Glycosylation
N86 N-Glycosylation

Research Backgrounds

Function:

Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.

PTMs:

Nitrated.

Subcellular Location:

Secreted.
Note: The proform is secreted.

Cytoplasmic vesicle>Secretory vesicle.
Note: The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule (crystalloid core).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Subunit Structure:

In pregnancy serum, the proform exists as a disulfide-linked 2:2 heterotetramer with PAPPA, as a disulfide-linked 2:2 heterotetramer with AGT, and as a complex (probably a 2:2:2 heterohexamer) with AGT and C3dg.

Research Fields

· Human Diseases > Immune diseases > Asthma.

References

1). MiR-223-3p regulates the eosinophil degranulation and enhances the inflammation in allergic rhinitis by targeting FBXW7. International Immunopharmacology, 2023 (PubMed: 36924565) [IF=5.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.