Product: BIK Antibody
Catalog: DF6958
Description: Rabbit polyclonal antibody to BIK
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 18kDa; 18kD(Calculated).
Uniprot: Q13323
RRID: AB_2838914

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
BIK Antibody detects endogenous levels of total BIK.
RRID:
AB_2838914
Cite Format: Affinity Biosciences Cat# DF6958, RRID:AB_2838914.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptosis inducer NBK; BBC1; Bcl-2-interacting killer; BCL2 interacting killer; bhikhari; BIK; Bik-like killer protein; BIK_HUMAN; BIP 1; BiP1; BP 4; BP4; cb 60; NBK;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Bik/Nbk (Bcl-2-interacting killer/natural born killer) is a potent pro-apoptotic protein belonging to a group of Bcl-2 family members that includes Bad, Bid, Bim, Hrk, and Noxa, containing a BH3 domain but lacking other conserved domains, BH1 or BH2 (1,2). Functionally, Bik is able to bind to and antagonize anti-apoptotic Bcl-2 family members including Bcl-2, Bcl-xL, and viral homologs E1B-19K and EBV-BHFR1. The BH3 domain of Bik is essential for its apoptotic activity and interaction with survival proteins (3). Phosphorylation of Bik is correlated with an increase in its pro-apoptotic activity (4).
Sequence:
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

PTMs - Q13323 As Substrate

Site PTM Type Enzyme
S2 Phosphorylation
T33 Phosphorylation P68400 (CSNK2A1)
S35 Phosphorylation P68400 (CSNK2A1)
K115 Ubiquitination
S124 Phosphorylation

Research Backgrounds

Function:

Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.

PTMs:

Proteolytically cleaved by RHBDL4/RHBDD1. RHBDL4/RHBDD1-induced cleavage is a necessary step prior its degradation by the proteosome-dependent mechanism.

Subcellular Location:

Endomembrane system>Single-pass membrane protein. Mitochondrion membrane>Single-pass membrane protein.
Note: Around the nuclear envelope, and in cytoplasmic membranes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with RHBDL4/RHBDD1.

Family&Domains:

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Endocrine resistance.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.