SELE/CD62E Antibody - #DF6914

(7)   (7)  
Product: SELE/CD62E Antibody
Catalog: DF6914
Description: Rabbit polyclonal antibody to SELE/CD62E
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 67kDa; 67kD(Calculated).
Uniprot: P16581
RRID: AB_2838873

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Bovine(83%), Horse(100%), Sheep(83%), Rabbit(92%), Dog(100%)
Clonality:
Polyclonal
Specificity:
SELE/CD62E Antibody detects endogenous levels of total SELE/CD62E.
RRID:
AB_2838873
Cite Format: Affinity Biosciences Cat# DF6914, RRID:AB_2838873.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD26E; CD62 antigen-like family member E; CD62E; E selectin; E-selectin; ELAM; ELAM-1; ELAM1; Endothelial adhesion molecule 1; Endothelial leukocyte adhesion molecule 1; ESEL; LECAM2; Leukocyte-endothelial cell adhesion molecule 2; LYAM2_HUMAN; Sele; Selectin E;

Immunogens

Immunogen:
Uniprot:

P16581(LYAM2_HUMAN) >>Visit HPA database.

Gene(ID):
SELE(6401)
Description:
The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq]
Sequence:
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Dog
100
Rabbit
92
Pig
91
Bovine
83
Sheep
83
Zebrafish
73
Xenopus
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P16581 As Substrate

Site PTM Type Enzyme
Y24 Phosphorylation
N25 N-Glycosylation
K76 Ubiquitination
K117 Ubiquitination
N145 N-Glycosylation
N160 N-Glycosylation
N179 N-Glycosylation
N199 N-Glycosylation
N203 N-Glycosylation
N265 N-Glycosylation
S318 Phosphorylation
S383 Phosphorylation
S385 Phosphorylation
S387 Phosphorylation
Y390 Phosphorylation
T452 Phosphorylation
Y453 Phosphorylation
Y603 Phosphorylation

Research Backgrounds

Function:

Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope. SELPLG sulfation appears not to be required for this interaction.

Family&Domains:

Belongs to the selectin/LECAM family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

References

1). Acadesine alleviates acute pancreatitis-related lung injury by mediating the barrier protective function of pulmonary microvascular endothelial cells. International Immunopharmacology, 2022 (PubMed: 35987144) [IF=5.6]
2). Nepeta angustifolia attenuates responses to vascular inflammation in high glucose-induced human umbilical vein endothelial cells through heme oxygenase-1 induction. JOURNAL OF ETHNOPHARMACOLOGY, 2019 (PubMed: 30419276) [IF=5.4]
3). The role of dendritic cells regulated by HMGB1/TLR4 signalling pathway in myocardial ischaemia reperfusion injury. JOURNAL OF CELLULAR AND MOLECULAR MEDICINE, 2019 (PubMed: 30784177) [IF=5.3]

Application: IHC    Species: rat    Sample: myocardial

FIGURE 2|HMGB1‐TLR4 signalling pathway mediates the migration, adhesion and activation of dendritic cells (DCs) in ischaemia‐reperfusion myocardium. D, Hematoxylin‐eosin (HE) staining pictures (200×) are shown in the left, immunohistochemical staining pictures (200×) are in the middle and right
4). Traditional Chinese Medicine Shi-Bi-Man ameliorates psoriasis via inhibiting IL-23/Th17 axis and CXCL16-mediated endothelial activation. Chinese medicine, 2024 (PubMed: 38429819) [IF=4.9]
5). Wenyang Huazhuo Tongluo formula alleviates pulmonary vascular injury and downregulates HIF-1α in bleomycin-induced systemic sclerosis mouse model. BMC Complementary Medicine and Therapies, 2022 (PubMed: 35733188) [IF=3.9]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 5Wenyang Huazhuo Tongluo Formula and KC7F2 can significantly inhibit the expression of vWF, SELE, ICAM-1 and VCAM-1 in bleomycin-induced SSc mouse model. The effect of Wenyang Huazhuo Tongluo Formula and KC7F2 on the expression of vWF (A), SELE (B), ICAM-1 (C) and VCAM-1 (D) was observed by immunofluorescence staining. compared with the PBS group, bleomycin can significantly upregulate the expression levels of vWF, SELE, ICAM-1 and VCAM-1 in endothelial cells, while Wenyang Huazhuo Tongluo Formula and KC7F2 can significantly reverse the bleomycin-induced upregulation of vWF, SELE, ICAM-1 and VCAM-1. The mean values ± SD was shown for each bar. * (P < 0.05) or ** (P < 0.01) or *** (P < 0.001) represents significance, ns represents no significance. Original magnification: × 20. BLM: Bleomycin, WYHZTL: Wenyang Huazhuo Tongluo formula
6). FebuxostatAlleviatesAllergicRhinitis by Inhibiting Inflammation and Monocyte Adhesion in Human Nasal Epithelial Cells via Regulating KLF6. Evidence-based Complementary and Alternative Medicine, 2022 (PubMed: 36118091)

Application: WB    Species: Human    Sample: hNECs

Figure 2 The expression level of chemokines, adhesion molecules, and KLF6 expression in histamine-treated hNECs were repressed by febuxostat. (a). The expression level of chemokines was measured by the RT-qPCR assay, (b) the production of chemokines was evaluated by the ELISA assay, (c) the expression level of CAMs was checked by the RT-qPCR assay, (d) the expression level of CAMs was measured by the Western blotting assay (p < 0.05 and p < 0.01), (e) the adhesion between hNECs and U937 monocytes was inhibited by febuxostat. The attached U937 monocytes were detected using the calcein-AM staining assay (p < 0.05 and p < 0.01), (f) the expression level of KLF6 was evaluated by the RT-qPCR assay, and (g) the expression level of KLF6 was determined by the Western blotting assay (p < 0.05 and p < 0.01). Immunofluorescence magnification was 10×.
7). Sitagliptin attenuates endothelial dysfunction independent of its blood glucose controlling effect. The Korean Journal of Physiology & Pharmacology : Official Journal of the Korean Physiological Society and the Korean Society of Pharmacology, 2021 (PubMed: 34448460)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.