PPP2R2A Antibody - #DF6908
Product: | PPP2R2A Antibody |
Catalog: | DF6908 |
Description: | Rabbit polyclonal antibody to PPP2R2A |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 52kDa; 52kD(Calculated). |
Uniprot: | P63151 |
RRID: | AB_2838867 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6908, RRID:AB_2838867.
Fold/Unfold
2ABA_HUMAN; Alpha isoform of regulatory subunit B55 protein phosphatase 2; B55A; B55ALPHA; calcineurin; PP2A subunit B B alpha isoform; PP2A subunit B B55 alpha isoform; PP2A subunit B isoform alpha; PP2A subunit B isoform B55-alpha; PP2A subunit B isoform PR55-alpha; PP2A subunit B isoform R2-alpha; PP2A subunit B PR55 alpha isoform; PP2A subunit B R2 alpha isoform; PPP2R2A; PR52A; PR55A; Protein phosphatase 2 (formerly 2A) regulatory subunit B (PR 52) alpha isoform; Protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform; Protein phosphatase 2 regulatory subunit B alpha; Protein phosphatase 2 regulatory subunit B alpha isoform; Protein phosphatase 2 regulatory subunit Balpha; Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform; Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform; Testicular tissue protein Li 156;
Immunogens
- P63151 2ABA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P63151 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K62 | Acetylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
R68 | Methylation | Uniprot | |
K88 | Acetylation | Uniprot | |
K88 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K98 | Acetylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K117 | Ubiquitination | Uniprot | |
K123 | Ubiquitination | Uniprot | |
K129 | Ubiquitination | Uniprot | |
K137 | Ubiquitination | Uniprot | |
S167 | Phosphorylation | Uniprot | |
S266 | Phosphorylation | Uniprot | |
K267 | Ubiquitination | Uniprot | |
R278 | Methylation | Uniprot | |
K292 | Ubiquitination | Uniprot | |
K332 | Ubiquitination | Uniprot | |
S335 | Phosphorylation | Uniprot | |
S355 | Phosphorylation | Uniprot | |
T359 | Phosphorylation | Uniprot | |
T378 | Phosphorylation | Uniprot | |
K387 | Ubiquitination | Uniprot | |
S400 | Phosphorylation | Q13315 (ATM) | Uniprot |
K402 | Acetylation | Uniprot | |
K404 | Ubiquitination | Uniprot | |
K405 | Ubiquitination | Uniprot | |
S409 | Phosphorylation | Uniprot | |
K417 | Ubiquitination | Uniprot | |
K418 | Ubiquitination | Uniprot | |
Y440 | Phosphorylation | Uniprot |
Research Backgrounds
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Expressed in all tissues examined.
Found in a complex with at least ARL2, PPP2CB, PPP2R1A, PPP2R2A, PPP2R5E and TBCD (By similarity). PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules (By similarity). Interacts with TP53. Interacts with IER5. Interacts with MFHAS1; the interaction is direct. Interacts with FAM122A. Interacts with CRTC3.
Belongs to the phosphatase 2A regulatory subunit B family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Nervous system > Dopaminergic synapse.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.