Cytochrome P450 2E1 Antibody | Affinity Biosciences

WB
IHC
Cites

1/10

Western blot analysis of CYP2E1 expression in Mouse Liver lysate.

DF6883 at 1/100 staining Mouse liver tissue by IHC-P.

DF6883 at 1/100 staining Rat liver tissue by IHC-P.

DF6883 at 1/100 staining Human normal tissues adjacent to liver cancer by IHC-P.

Fig.

Figure 6.

FIGURE 3 Effect of ROF on CYP2E1 protein and TLR4/NF-κB axis in mice.

Effects of ROF on CYP2E1 protein expression and TLR4/NF-κB signaling pathway in LO2 cells.

FIGURE 6 Roxadustat reduces oxidative stress in mouse liver by enhancing SOD1 and decreasing CYP2E1 expression.

Figure 4 Effect of DOFE on Nrf2/HO-1-mediated antioxidant response.

Product:	Cytochrome P450 2E1 Antibody
Catalog:	DF6883
Description:	Rabbit polyclonal antibody to Cytochrome P450 2E1
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.:	57kDa; 57kD(Calculated).
Uniprot:	P05181
RRID:	AB_2838842

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)

Clonality:

Polyclonal

Specificity:

Cytochrome P450 2E1 Antibody detects endogenous levels of total Cytochrome P450 2E1.

RRID:

AB_2838842
Cite Format: Affinity Biosciences Cat# DF6883, RRID:AB_2838842.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

4-nitrophenol 2-hydroxylase; CP2E1_HUMAN; CPE1; CYP2E; Cyp2e1; CYPIIE1; Cytochrome P450 2E1; Cytochrome P450 isozyme 3A; Cytochrome P450 LM3A; Cytochrome P450, family 2, subfamily e, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; Cytochrome P450, subfamily IIE; Cytochrome P450-ALC; Cytochrome P450-J; Cytochrome P450RLM6; EC 1.14.13.-; EC 1.14.13.n7; Ethanol-inducible P450; Flavoprotein-linked monooxygenase; MGC133529; Microsomal monooxygenase; OTTHUMP00000020813; OTTHUMP00000046571; P450 ALC; P450-J; P450C2E; P450J; P450RLM6; Xenobiotic monooxygenase;

Immunogens

Immunogen:

Uniprot:

P05181(CP2E1_HUMAN) >>Visit HPA database.

Gene(ID):

CYP2E1(1571)

Description:

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]

Sequence:

P05181 CP2E1_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Dog

100

Rabbit

100

Xenopus

Sheep

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P05181 As Substrate

P05181

Site	PTM Type	Source
S56	Phosphorylation	Uniprot
T58	Phosphorylation	Uniprot
T69	Phosphorylation	Uniprot
S74	Phosphorylation	Uniprot
Y83	Phosphorylation	Uniprot
K84	Ubiquitination	Uniprot
K87	Ubiquitination	Uniprot
K94	Ubiquitination	Uniprot
T121	Phosphorylation	Uniprot
S129	Phosphorylation	Uniprot
T131	Phosphorylation	Uniprot
T132	Phosphorylation	Uniprot
S145	Phosphorylation	Uniprot
Y245	Phosphorylation	Uniprot
S247	Phosphorylation	Uniprot
K251	Ubiquitination	Uniprot
S256	Phosphorylation	Uniprot
K275	Ubiquitination	Uniprot
T373	Phosphorylation	Uniprot
T376	Phosphorylation	Uniprot
T387	Phosphorylation	Uniprot
K410	Ubiquitination	Uniprot
K420	Ubiquitination	Uniprot
K422	Ubiquitination	Uniprot
S424	Phosphorylation	Uniprot
K428	Ubiquitination	Uniprot
S431	Phosphorylation	Uniprot
T432	Phosphorylation	Uniprot
K434	Ubiquitination	Uniprot
K461	Ubiquitination	Uniprot

Research Backgrounds

P05181_CP2E1_HUMAN

Function:

A cytochrome P450 monooxygenase involved in the metabolism of fatty acids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids. May be involved in the oxidative metabolism of xenobiotics (Probable).

Subcellular Location:

Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein. Mitochondrion inner membrane>Peripheral membrane protein.
Note: Post-translationally targeted to mitochondria. TOMM70 is required for the translocation across the mitochondrial outer membrane. After translocation into the matrix, associates with the inner membrane as a membrane extrinsic protein.

Subunit Structure:

Interacts with chaperones HSP70 and HSP90; this interaction is required for initial targeting to mitochondria.

Family&Domains:

Belongs to the cytochrome P450 family.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). A Biomimetic Nanoparticle Exerting Protection against Acute Liver Failure by Suppressing CYP2E1 Activity and Scavenging Excessive ROS. Advanced Healthcare Materials (PubMed: 37236618) [IF=10.0]

2). Cooperative STAT3-NFkB signaling modulates mitochondrial dysfunction and metabolic profiling in hepatocellular carcinoma. Metabolism: clinical and experimental (PubMed: 38184165) [IF=9.8]

3). Roxadustat, a Hypoxia-Inducible Factor 1α Activator, Attenuates Both Long-and Short-Term Alcohol-Induced Alcoholic Liver Disease. Frontiers in Pharmacology (PubMed: 35620283) [IF=5.6]

Application: WB Species: mouse Sample: liver

FIGURE 6 Roxadustat reduces oxidative stress in mouse liver by enhancing SOD1 and decreasing CYP2E1 expression. (A) Superoxide in the liver was determined by DHE staining; (B,C) total protein extracted from the liver of acute ALD mouse (B) and chronic ALD mouse (C) was used to determine the protein expression of SOD1, SOD2, HIF-1α, and CYP2E1 using Western blot with quantitative analysis of band density (right panels). ***, p < 0.001 vs ctrl group; #, p < 0.05, ###, p < 0.001 vs ALD group (n ≥ 3).

4). Rhoifolin Alleviates Alcoholic Liver Disease In Vivo and In Vitro via Inhibition of the TLR4/NF-κB Signaling Pathway. Frontiers in Pharmacology (PubMed: 35685625) [IF=5.6]

Application: IHC Species: Mice Sample: liver tissues

FIGURE 3 Effect of ROF on CYP2E1 protein and TLR4/NF-κB axis in mice. The expression of CYP2E1 (A) and p65 (B) in the liver tissues detected by immunohistochemical staining (×200 magnification ). The protein levels of NLRP3, TLR4, and pp65 were detected by Western blotting (C). Mean ± SEM (n = 3). *p < 0.05, **p < 0.01 and ***p < 0.001 vs. the ETH group. ##p < 0.01 vs. the CON group.

Application: WB Species: Human Sample: LO2 cells

Effects of ROF on CYP2E1 protein expression and TLR4/NF-κB signaling pathway in LO2 cells. The cells were assigned to CON, ETH, and ROF (25, 50, 100 μmol L−1) groups. The expression levels of CYP2E1 (A), and TLR4, NLRP3, IκBα, p65, and their phosphorylated proteins were evaluated by Western blotting (B, C). The mechanism by which ROF alleviates ALD is shown in (D). Mean ± SEM (n = 3). *p < 0.05, **p < 0.01, and ***p < 0.001 vs. the ETH group. #p < 0.05, ##p < 0.01, and ###p < 0.001 vs. the CON group.

5). Patchouli alcohol ameliorates acute liver injury via inhibiting oxidative stress and gut-origin LPS leakage in rats. International Immunopharmacology (PubMed: 34182243) [IF=5.6]

6). Tetrahydrocurcumin and octahydrocurcumin, the primary and final hydrogenated metabolites of curcumin, possess superior hepatic-protective effect against acetaminophen-induced liver injury: Role of CYP2E1 and Keap1-Nrf2 pathway. FOOD AND CHEMICAL TOXICOLOGY (PubMed: 30423402) [IF=4.3]

Application: WB Species: mouse Sample: liver

Figure 6. | Differential effects of THC, OHC and CUR on the Keap1-Nrf2 pathway in liver. (A)Representative protein expression bands of Keap1 and Nrf2; (B) Cytosolic Keap1 protein level; (C)Cytosolic Nrf2 protein level; (D) Nuclear Nrf2 protein level. Data are presented as the mean ± SD(n = 3). ##p < 0.01 versus control group. *p < 0.05, **p < 0.01 versus APAP-treated group. ∆p < 0.05,∆∆p < 0.01 versus treatment of CUR group.

7). CYP2E1 triggered GRP78/ATF6/CHOP signaling axis inhibit apoptosis and promotes progression of hepatocellular carcinoma. Archives of Biochemistry and Biophysics (PubMed: 37499993) [IF=3.9]

8). Evaluation of in vitro/in vivo anti-diabetic effects and identification of compounds from Physalis alkekengi. Fitoterapia (PubMed: 29447981) [IF=3.4]

Application: WB Species: rat Sample: E47 cells

Fig. 4. |(A) 3T3-L1 preadipocytes were successfully differentiated into adipocytes. (B) Expression levels of CYP2E1 protein and mRNA were reduced after treatment with PAG-EA and PAF-EA for 48 h in E47 cells. (C) PAG-EA and PAF-EA significantly increased the GLUT4 protein and mRNA expression after 48 h. The CYP2E1 and GLUT4 mRNA values are represented as a fold change. *p < 0.05 and **p < 0.01 represent statistical significance against the control.

9). Dendrobium officinale Flower Extraction Mitigates Alcohol-Induced Liver Injury in Mice: Role of Antisteatosis, Antioxidative, and Anti-Inflammatory. Evidence-Based Complementary and Alternative Medicine (PubMed: 33149748)

Application: WB Species: Mouse Sample:

Figure 4 Effect of DOFE on Nrf2/HO-1-mediated antioxidant response. (a) The expressions of the CYP2E1, Cytosol Nrf2, HO-1, and nuclear Nrf2 were assessed by Western Blotting (n = 3). β-actin and Histone H3 were used as a loading control. Relative mRNA expression of (b) CYP2E1, (c) HO-1, and (d) NQO1. All data are expressed as mean ± SD (n = 8). #p < 0.05, ##p < 0.01 vs. normal control group; ∗p < 0.05, ∗∗p < 0.01 vs. model group.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

Cytochrome P450 2E1 Antibody - #DF6883