Product: Cytochrome P450 2E1 Antibody
Catalog: DF6883
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 57kD; 57kD(Calculated).
Uniprot: P05181
RRID: AB_2838842

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Cytochrome P450 2E1 Antibody detects endogenous levels of total Cytochrome P450 2E1.
RRID:
AB_2838842
Cite Format: Affinity Biosciences Cat# DF6883, RRID:AB_2838842.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4-nitrophenol 2-hydroxylase; CP2E1_HUMAN; CPE1; CYP2E; Cyp2e1; CYPIIE1; Cytochrome P450 2E1; Cytochrome P450 isozyme 3A; Cytochrome P450 LM3A; Cytochrome P450, family 2, subfamily e, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; Cytochrome P450, subfamily IIE; Cytochrome P450-ALC; Cytochrome P450-J; Cytochrome P450RLM6; EC 1.14.13.-; EC 1.14.13.n7; Ethanol-inducible P450; Flavoprotein-linked monooxygenase; MGC133529; Microsomal monooxygenase; OTTHUMP00000020813; OTTHUMP00000046571; P450 ALC; P450-J; P450C2E; P450J; P450RLM6; Xenobiotic monooxygenase;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]
Sequence:
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Xenopus
75
Sheep
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P05181 As Substrate

Site PTM Type Enzyme
S56 Phosphorylation
T58 Phosphorylation
T69 Phosphorylation
S74 Phosphorylation
Y83 Phosphorylation
K84 Ubiquitination
K87 Ubiquitination
K94 Ubiquitination
T121 Phosphorylation
S129 Phosphorylation
T131 Phosphorylation
T132 Phosphorylation
S145 Phosphorylation
Y245 Phosphorylation
S247 Phosphorylation
K251 Ubiquitination
S256 Phosphorylation
K275 Ubiquitination
T373 Phosphorylation
T376 Phosphorylation
T387 Phosphorylation
K410 Ubiquitination
K420 Ubiquitination
K422 Ubiquitination
S424 Phosphorylation
K428 Ubiquitination
S431 Phosphorylation
T432 Phosphorylation
K434 Ubiquitination
K461 Ubiquitination

Research Backgrounds

Function:

A cytochrome P450 monooxygenase involved in the metabolism of fatty acids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids. May be involved in the oxidative metabolism of xenobiotics (Probable).

Subcellular Location:

Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein. Mitochondrion inner membrane>Peripheral membrane protein.
Note: Post-translationally targeted to mitochondria. TOMM70 is required for the translocation across the mitochondrial outer membrane. After translocation into the matrix, associates with the inner membrane as a membrane extrinsic protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with chaperones HSP70 and HSP90; this interaction is required for initial targeting to mitochondria.

Family&Domains:

Belongs to the cytochrome P450 family.

Research Fields

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

· Metabolism > Global and overview maps > Metabolic pathways.

References

1). Gao Y et al. Roxadustat, a Hypoxia-Inducible Factor 1α Activator, Attenuates Both Long-and Short-Term Alcohol-Induced Alcoholic Liver Disease. Front Pharmacol 2022 May 10;13:895710. (PubMed: 35620283) [IF=5.810]

2). Mai B et al. Rhoifolin Alleviates Alcoholic Liver Disease In Vivo and In Vitro via Inhibition of the TLR4/NF-κB Signaling Pathway. Front Pharmacol 2022 May 24;13:878898. (PubMed: 35685625) [IF=5.810]

Application: IHC    Species: Mice    Sample: liver tissues

FIGURE 3 Effect of ROF on CYP2E1 protein and TLR4/NF-κB axis in mice. The expression of CYP2E1 (A) and p65 (B) in the liver tissues detected by immunohistochemical staining (×200 magnification ). The protein levels of NLRP3, TLR4, and pp65 were detected by Western blotting (C). Mean ± SEM (n = 3). *p < 0.05, **p < 0.01 and ***p < 0.001 vs. the ETH group. ##p < 0.01 vs. the CON group.

Application: WB    Species: Human    Sample: LO2 cells

Effects of ROF on CYP2E1 protein expression and TLR4/NF-κB signaling pathway in LO2 cells. The cells were assigned to CON, ETH, and ROF (25, 50, 100 μmol L−1) groups. The expression levels of CYP2E1 (A), and TLR4, NLRP3, IκBα, p65, and their phosphorylated proteins were evaluated by Western blotting (B, C). The mechanism by which ROF alleviates ALD is shown in (D). Mean ± SEM (n = 3). *p < 0.05, **p < 0.01, and ***p < 0.001 vs. the ETH group. #p < 0.05, ##p < 0.01, and ###p < 0.001 vs. the CON group.

3). Luo DD et al. Tetrahydrocurcumin and octahydrocurcumin, the primary and final hydrogenated metabolites of curcumin, possess superior hepatic-protective effect against acetaminophen-induced liver injury: Role of CYP2E1 and Keap1-Nrf2 pathway. Food Chem Toxicol 2018 Nov 10 (PubMed: 30423402) [IF=5.572]

Application: WB    Species: mouse    Sample: liver

Figure 6. | Differential effects of THC, OHC and CUR on the Keap1-Nrf2 pathway in liver. (A)Representative protein expression bands of Keap1 and Nrf2; (B) Cytosolic Keap1 protein level; (C)Cytosolic Nrf2 protein level; (D) Nuclear Nrf2 protein level. Data are presented as the mean ± SD(n = 3). ##p < 0.01 versus control group. *p < 0.05, **p < 0.01 versus APAP-treated group. ∆p < 0.05,∆∆p < 0.01 versus treatment of CUR group.

4). Hu XF et al. Evaluation of in vitro/in vivo anti-diabetic effects and identification of compounds from Physalis alkekengi. Fitoterapia 2018 Jun;127:129-137 (PubMed: 29447981) [IF=3.204]

Application: WB    Species: rat    Sample: E47 cells

Fig. 4. |(A) 3T3-L1 preadipocytes were successfully differentiated into adipocytes. (B) Expression levels of CYP2E1 protein and mRNA were reduced after treatment with PAG-EA and PAF-EA for 48 h in E47 cells. (C) PAG-EA and PAF-EA significantly increased the GLUT4 protein and mRNA expression after 48 h. The CYP2E1 and GLUT4 mRNA values are represented as a fold change. *p < 0.05 and **p < 0.01 represent statistical significance against the control.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.