SPDYA Antibody - #DF6876
Product: | SPDYA Antibody |
Catalog: | DF6876 |
Description: | Rabbit polyclonal antibody to SPDYA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 36kDa; 36kD(Calculated). |
Uniprot: | Q5MJ70 |
RRID: | AB_2838835 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6876, RRID:AB_2838835.
Fold/Unfold
hSpy/Ringo A; MGC110856; MGC57218; OTTHUMP00000082662; OTTHUMP00000082663; OTTHUMP00000082664; Rapid inducer of G2/M progression in oocytes A; RINGO A; RINGO3; SPDY1; Speedy A; Speedy homolog 1 (Drosophila); Speedy homolog A; Speedy homolog A (Xenopus laevis); Speedy-1; SPY1;
Immunogens
Highly expressed in testis. Expressed at a low level in wide range of tissues including bone marrow, brain, heart, kidney, colon, liver, placenta, spleen, skeletal muscle, salivary gland, thyroid gland, thymus, trachea and uterus. Expressed at a slightly higher level in adrenal gland, cerebellum, small intestine, lung, prostate and trachea. Expression is cell cycle-dependent, being restricted to cells in G1/S phase.
- Q5MJ70 SPDYA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q5MJ70 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S247 | Phosphorylation | Uniprot | |
T252 | Phosphorylation | Uniprot | |
T256 | Phosphorylation | Uniprot |
Research Backgrounds
Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1 and CDK2. Contributes to CDK2 activation without promoting CDK2 phosphorylation, by inducing a conformation change of the CDK2 T-loop that obstructs the substrate-binding cleft prior to kinase activation. Mediates cell survival during the DNA damage process through activation of CDK2.
Nucleus.
Highly expressed in testis. Expressed at a low level in wide range of tissues including bone marrow, brain, heart, kidney, colon, liver, placenta, spleen, skeletal muscle, salivary gland, thyroid gland, thymus, trachea and uterus. Expressed at a slightly higher level in adrenal gland, cerebellum, small intestine, lung, prostate and trachea. Expression is cell cycle-dependent, being restricted to cells in G1/S phase.
Interacts with CDK1 (By similarity). Interacts with CDK2. May interact with CDKN1B/KIP1. Identified in a complex with CDK2 and CDKN1B/KIP1, where it interacts primarily with CDK2.
The C-terminus is required for CDK2-activation, but not CDK2-binding.
Belongs to the Speedy/Ringo family.
Research Fields
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.