SORD Antibody - #DF6842
Product: | SORD Antibody |
Catalog: | DF6842 |
Description: | Rabbit polyclonal antibody to SORD |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 38kDa; 38kD(Calculated). |
Uniprot: | Q00796 |
RRID: | AB_2838801 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6842, RRID:AB_2838801.
Fold/Unfold
DHSO_HUMAN; L iditol 2 dehydrogenase; L-iditol 2-dehydrogenase; OTTHUMP00000161939; SDH; Sorbitol dehydrogenase 1; Sorbitol dehydrogenase; SORD 1; SORD; SORD1;
Immunogens
Expressed in liver (PubMed:3365415). Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
- Q00796 DHSO_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00796 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K6 | Acetylation | Uniprot | |
K6 | Ubiquitination | Uniprot | |
S11 | Phosphorylation | Uniprot | |
Y25 | Phosphorylation | Uniprot | |
Y51 | Phosphorylation | Uniprot | |
Y54 | Phosphorylation | Uniprot | |
K64 | Ubiquitination | Uniprot | |
K78 | Ubiquitination | Uniprot | |
K84 | Ubiquitination | Uniprot | |
K107 | Ubiquitination | Uniprot | |
T122 | Phosphorylation | Uniprot | |
K134 | Ubiquitination | Uniprot | |
R167 | Methylation | Uniprot | |
S206 | Phosphorylation | Uniprot | |
T208 | Phosphorylation | Uniprot | |
S211 | Phosphorylation | Uniprot | |
S225 | Phosphorylation | Uniprot | |
K226 | Ubiquitination | Uniprot | |
S228 | Phosphorylation | Uniprot | |
K295 | Ubiquitination | Uniprot | |
K319 | Ubiquitination | Uniprot | |
K339 | Acetylation | Uniprot | |
K339 | Ubiquitination | Uniprot | |
K349 | Ubiquitination | Uniprot |
Research Backgrounds
Polyol dehydrogenase that catalyzes the reversible NAD(+)-dependent oxidation of various sugar alcohols. Is mostly active with D-sorbitol (D-glucitol), L-threitol, xylitol and ribitol as substrates, leading to the C2-oxidized products D-fructose, L-erythrulose, D-xylulose, and D-ribulose, respectively. Is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. The polyol pathway is believed to be involved in the etiology of diabetic complications, such as diabetic neuropathy and retinopathy, induced by hyperglycemia. May play a role in sperm motility by using sorbitol as an alternative energy source for sperm motility. May have a more general function in the metabolism of secondary alcohols since it also catalyzes the stereospecific oxidation of (2R,3R)-2,3-butanediol. To a lesser extent, can also oxidize L-arabinitol, galactitol and D-mannitol and glycerol in vitro. Oxidizes neither ethanol nor other primary alcohols. Cannot use NADP(+) as the electron acceptor.
Mitochondrion membrane>Peripheral membrane protein. Cell projection>Cilium>Flagellum.
Note: Associated with mitochondria of the midpiece and near the plasma membrane in the principal piece of the flagellum. Also found in the epididymosome, secreted by the epididymal epithelium and that transfers proteins from the epididymal fluid to the sperm surface.
Expressed in liver. Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
Homotetramer.
Belongs to the zinc-containing alcohol dehydrogenase family.
Research Fields
· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.
· Metabolism > Carbohydrate metabolism > Fructose and mannose metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.