CTLA4 Antibody - #DF6793

Product: | CTLA4 Antibody |
Catalog: | DF6793 |
Description: | Rabbit polyclonal antibody to CTLA4 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Rabbit, Dog, Chicken |
Mol.Wt.: | 25kDa; 25kD(Calculated). |
Uniprot: | P16410 |
RRID: | AB_2838755 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6793, RRID:AB_2838755.
Fold/Unfold
ALPS5; CD 152; CD; CD152; CD152 antigen; CD152 isoform; Celiac disease 3; CELIAC3; CTLA 4; CTLA-4; CTLA4; CTLA4_HUMAN; Cytotoxic T cell associated 4; Cytotoxic T lymphocyte antigen 4; Cytotoxic T lymphocyte associated 4; Cytotoxic T lymphocyte associated 4, soluble isoform, included; Cytotoxic T lymphocyte associated antigen 4; Cytotoxic T lymphocyte associated antigen 4 short spliced form; Cytotoxic T lymphocyte associated protein 4; Cytotoxic T lymphocyte associated serine esterase 4; Cytotoxic T lymphocyte protein 4; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; GRD4; GSE; ICOS; IDDM12; insulin-dependent diabetes mellitus 12; Ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; OTTHUMP00000216623;
Immunogens
Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
- P16410 CTLA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P16410 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S55 | Phosphorylation | Uniprot | |
Y60 | Phosphorylation | Uniprot | |
N113 | N-Glycosylation | Uniprot | |
N145 | N-Glycosylation | Uniprot | |
Y165 | Phosphorylation | Uniprot | |
Y182 | Phosphorylation | Uniprot | |
Y201 | Phosphorylation | P06239 (LCK) , P42681 (TXK) , O60674 (JAK2) , P06241 (FYN) | Uniprot |
Y218 | Phosphorylation | P06239 (LCK) , P06241 (FYN) | Uniprot |
Research Backgrounds
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
N-glycosylation is important for dimerization.
Phosphorylation at Tyr-201 prevents binding to the AP-2 adapter complex, blocks endocytosis, and leads to retention of CTLA4 on the cell surface.
Cell membrane>Single-pass type I membrane protein.
Note: Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalisation;.
Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
Homodimer; disulfide-linked Ref.23,. Binds to CD80/B7-1 and CD86/B7.2. Interacts with ICOSLG.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Immune diseases > Autoimmune thyroid disease.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
References
Application: IHC Species: Human Sample: tumor tissues
Application: IF/ICC Species: Human Sample: HCC tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.