AK4 Antibody - #DF6781
Product: | AK4 Antibody |
Catalog: | DF6781 |
Description: | Rabbit polyclonal antibody to AK4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25kDa; 25kD(Calculated). |
Uniprot: | P27144 |
RRID: | AB_2838743 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6781, RRID:AB_2838743.
Fold/Unfold
Adenylate kinase 3 like 1; Adenylate kinase 3-like; adenylate kinase 4; Adenylate kinase isoenzyme 4, mitochondrial; AK3; AK3L1; AK3L2; AK4; ATP-AMP transphosphorylase; GTP:AMP phosphotransferase; KAD4_HUMAN; MGC166959; mitochondrial adenylate kinase 3; nucleoside-triphosphate adenylate kinase;
Immunogens
Highly expressed in kidney, moderately expressed in heart and liver and weakly expressed in brain.
- P27144 KAD4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P27144 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K4 | Acetylation | Uniprot | |
S75 | Phosphorylation | Uniprot | |
T93 | Phosphorylation | Uniprot | |
K179 | Acetylation | Uniprot | |
K179 | Ubiquitination | Uniprot | |
K186 | Acetylation | Uniprot | |
R188 | Methylation | Uniprot | |
Y205 | Phosphorylation | Uniprot | |
S219 | Phosphorylation | Uniprot | |
K220 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Efficiently phosphorylates AMP and dAMP using ATP as phosphate donor, but phosphorylates only AMP when using GTP as phosphate donor. Also displays broad nucleoside diphosphate kinase activity. Plays a role in controlling cellular ATP levels by regulating phosphorylation and activation of the energy sensor protein kinase AMPK. Plays a protective role in the cellular response to oxidative stress.
Mitochondrion matrix.
Highly expressed in kidney, moderately expressed in heart and liver and weakly expressed in brain.
Monomer (Ref.17). Interacts with SLC25A5/ANT2.
Consists of three domains, a large central CORE domain and two small peripheral domains, NMPbind and LID, which undergo movements during catalysis. The LID domain closes over the site of phosphoryl transfer upon GTP/ATP binding. Assembling and dissambling the active center during each catalytic cycle provides an effective means to prevent GTP/ATP hydrolysis.
Belongs to the adenylate kinase family. AK3 subfamily.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Thiamine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.