Product: KLRD1 Antibody
Catalog: DF6773
Description: Rabbit polyclonal antibody to KLRD1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 20kDa; 21kD(Calculated).
Uniprot: Q13241
RRID: AB_2838735

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
KLRD1 Antibody detects endogenous levels of total KLRD1.
RRID:
AB_2838735
Cite Format: Affinity Biosciences Cat# DF6773, RRID:AB_2838735.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD 94; CD94; CD94 antigen; Killer cell lectin like receptor subfamily D member 1; Killer cell lectin-like receptor subfamily D member 1; KLRD 1; KLRD1; KLRD1 protein; KLRD1_HUMAN; KP 43; KP43; Natural killer cells antigen CD94; NK cell receptor; OTTHUMP00000238754; OTTHUMP00000238755; OTTHUMP00000238756; OTTHUMP00000238758; OTTHUMP00000239093;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q13241 KLRD1_HUMAN:

Natural killer cells.

Description:
Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Sequence:
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

PTMs - Q13241 As Substrate

Site PTM Type Enzyme
S13 Phosphorylation
T15 Phosphorylation
Y73 Phosphorylation

Research Backgrounds

Function:

Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Subcellular Location:

Cell membrane>Single-pass type II membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Natural killer cells.

Subunit Structure:

Can form disulfide-bonded heterodimer with NKG2 family members. KLRD1-KLRC1 heterodimer interacts with peptide-bound HLA-E-B2M heterotrimeric complex. KLRD1 plays a prominent role in directly interacting with HLA-E. Interacts with the adapter protein TYROBP/DAP12; the interaction leads to natural killer cell activation.

Research Fields

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). Single-cell analysis of gastric signet ring cell carcinoma reveals cytological and immune microenvironment features. Nature Communications, 2023 (PubMed: 37225691) [IF=16.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.