CD99 Antibody - #DF6762
Product: | CD99 Antibody |
Catalog: | DF6762 |
Description: | Rabbit polyclonal antibody to CD99 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Bovine |
Mol.Wt.: | 28kDa; 19kD(Calculated). |
Uniprot: | P14209 |
RRID: | AB_2838724 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6762, RRID:AB_2838724.
Fold/Unfold
12E7; Antigen identified by monoclonal 12E7, Y homolog; Antigen identified by monoclonal antibodies 12E7, F21 and O13; CD99; CD99 antigen; CD99 molecule; CD99_HUMAN; Cell surface antigen 12E7; Cell surface antigen HBA 71; Cell surface antigen O13; E2 antigen; HBA71; MIC 2X; MIC 2Y; MIC2 (monoclonal antibody 12E7); MIC2; MIC2X; MIC2Y; MSK5X; Protein MIC2; Surface antigen MIC2; T cell surface glycoprotein E2; T-cell surface glycoprotein E2;
Immunogens
- P14209 CD99_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14209 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S29 | Phosphorylation | Uniprot | |
T41 | O-Glycosylation | Uniprot | |
K156 | Ubiquitination | Uniprot | |
S168 | Phosphorylation | Uniprot | |
T181 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes (By similarity).
Extensively O-glycosylated.
Membrane>Single-pass type I membrane protein.
Belongs to the CD99 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.