Product: RPS27A Antibody
Catalog: DF6761
Description: Rabbit polyclonal antibody to RPS27A
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus
Mol.Wt.: 9kDa; 18kD(Calculated).
Uniprot: P62979
RRID: AB_2838723

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
RPS27A Antibody detects endogenous levels of total RPS27A.
RRID:
AB_2838723
Cite Format: Affinity Biosciences Cat# DF6761, RRID:AB_2838723.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

40S ribosomal protein S27a; CEP 80; CEP80; HUBCEP 80; HUBCEP80; Ribosomal protein S27a; RPS 27A; UBA 80; UBA80; UBCEP 1; UBCEP 80; UBCEP1; UBCEP80; Ubiquitin and ribosomal protein S27a; Ubiquitin carboxyl extension protein 80; Ubiquitin CEP80;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]
Sequence:
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P62979 As Substrate

Site PTM Type Enzyme
K6 Acetylation
K6 Methylation
K6 Sumoylation
K6 Ubiquitination
T7 Phosphorylation
K11 Acetylation
K11 Sumoylation
K11 Ubiquitination
T12 Phosphorylation
T14 Phosphorylation
S20 Phosphorylation
T22 Phosphorylation
K27 Sumoylation
K27 Ubiquitination
K29 Sumoylation
K29 Ubiquitination
K33 Sumoylation
K33 Ubiquitination
K48 Acetylation
K48 Sumoylation
K48 Ubiquitination
S57 Phosphorylation
Y59 Phosphorylation
K63 Methylation
K63 Sumoylation
K63 Ubiquitination
S65 Phosphorylation
T66 Phosphorylation
R72 Methylation
S84 Phosphorylation
T87 Phosphorylation
K89 Ubiquitination
K99 Acetylation
K99 Ubiquitination
K104 Acetylation
K104 Ubiquitination
K107 Acetylation
K107 Ubiquitination
K113 Acetylation
K113 Ubiquitination
S115 Phosphorylation
R119 Methylation
S123 Phosphorylation
R138 Methylation
K143 Acetylation
K143 Ubiquitination
C144 S-Nitrosylation
C145 S-Nitrosylation
T147 Phosphorylation
Y148 Phosphorylation
C149 S-Nitrosylation
K152 Acetylation
K152 Ubiquitination
K156 Acetylation
K156 Ubiquitination

Research Backgrounds

Function:

Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.

Component of the 40S subunit of the ribosome.

PTMs:

Phosphorylated at Ser-65 by PINK1 during mitophagy. Phosphorylated ubiquitin specifically binds and activates parkin (PRKN), triggering mitophagy. Phosphorylation does not affect E1-mediated E2 charging of ubiquitin but affects discharging of E2 enzymes to form polyubiquitin chains. It also affects deubiquitination by deubiquitinase enzymes such as USP30.

Mono-ADP-ribosylated at the C-terminus by PARP9, a component of the PPAR9-DTX3L complex. ADP-ribosylation requires processing by E1 and E2 enzymes and prevents ubiquitin conjugation to substrates such as histones.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Ribosomal protein S27a is part of the 40S ribosomal subunit.

Family&Domains:

In the N-terminal section; belongs to the ubiquitin family.

In the C-terminal section; belongs to the eukaryotic ribosomal protein eS31 family.

Research Fields

· Genetic Information Processing > Translation > Ribosome.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.